msgid ""
msgstr ""
"Project-Id-Version: Double Commander 0.8.0 alpha Rev. 6885\n"
"Report-Msgid-Bugs-To: \n"
"POT-Creation-Date: 2009-12-20 12:40+0300\n"
"PO-Revision-Date: 2018-03-05 13:31+0100\n"
"Last-Translator: Claudio <linuxbastler@users.sourceforge.net>\n"
"Language-Team: Deutsch <linuxbastler@users.sourceforge.net>\n"
"MIME-Version: 1.0\n"
"Content-Type: text/plain; charset=utf-8\n"
"Content-Transfer-Encoding: 8bit\n"
"X-Native-Language: Deutsch\n"
"Language: de\n"
"X-Generator: Poedit 2.0.4\n"

#: fsyncdirsdlg.rscomparingpercent
msgid "Comparing... %d%% (ESC to cancel)"
msgstr "Vergleiche... %d%% (ESC zum Abbrechen)"

#: fsyncdirsdlg.rsdeleteright
msgid "Right: Delete %d file(s)"
msgstr "Lösche Datei(en) %d"

#: fsyncdirsdlg.rsfilesfound
msgid "Files found: %d  (Identical: %d, Different: %d, Unique left: %d, Unique right: %d)"
msgstr "Dateien gefunden: %d (Identisch: %d, Unterschiedlich: %d, nur links: %d, nur rechts: %d)"

#: fsyncdirsdlg.rslefttorightcopy
msgid "Left to Right: Copy %d files, total size: %d bytes"
msgstr "Links nach rechts: Kopiere %d Dateien, Gesamtgröße: %d Bytes"

#: fsyncdirsdlg.rsrighttoleftcopy
msgid "Right to Left: Copy %d files, total size: %d bytes"
msgstr "Rechts nach links: Kopiere %d Dateien, Gesamtgröße: %d Bytes"

#: tfilesystemcopymoveoperationoptionsui.btnsearchtemplate.hint
msgid "Choose template..."
msgstr "Vorlage wählen..."

#: tfilesystemcopymoveoperationoptionsui.cbcheckfreespace.caption
msgid "C&heck free space"
msgstr "Prüfe freien Speic&her"

#: tfilesystemcopymoveoperationoptionsui.cbcopyattributes.caption
msgid "Cop&y attributes"
msgstr "Attribute ko&pieren"

#: tfilesystemcopymoveoperationoptionsui.cbcopyownership.caption
msgid "Copy o&wnership"
msgstr "Besitzer k&opieren"

#: tfilesystemcopymoveoperationoptionsui.cbcopypermissions.caption
msgid "Copy &permissions"
msgstr "Berechtigungen ko&pieren"

#: tfilesystemcopymoveoperationoptionsui.cbcopytime.caption
msgctxt "tfilesystemcopymoveoperationoptionsui.cbcopytime.caption"
msgid "Copy d&ate/time"
msgstr "D&atum/Zeit kopieren"

#: tfilesystemcopymoveoperationoptionsui.cbcorrectlinks.caption
msgid "Correct lin&ks"
msgstr "&Korrigiere Verknüpfungen"

#: tfilesystemcopymoveoperationoptionsui.cbdropreadonlyflag.caption
msgid "Drop readonly fla&g"
msgstr "Sch&reibschutz-Attribut entfernen"

#: tfilesystemcopymoveoperationoptionsui.cbexcludeemptydirectories.caption
msgid "E&xclude empty directories"
msgstr "Leere &Verzeichnisse ignorieren"

#: tfilesystemcopymoveoperationoptionsui.cbfollowlinks.caption
msgid "Fo&llow links"
msgstr "Fo&lge Verknüpfungen"

#: tfilesystemcopymoveoperationoptionsui.cbreservespace.caption
msgid "&Reserve space"
msgstr "Speicherplatz &reservieren"

#: tfilesystemcopymoveoperationoptionsui.chkverify.caption
msgid "&Verify"
msgstr ""

#: tfilesystemcopymoveoperationoptionsui.cmbsetpropertyerror.hint
msgid "What to do when cannot set file time, attributes, etc."
msgstr "Was soll getan werden, wenn Dateieigenschaften nicht übernommen werden können"

#: tfilesystemcopymoveoperationoptionsui.gbfiletemplate.caption
msgid "Use file template"
msgstr "Vorlage aus Datei übernehmen"

#: tfilesystemcopymoveoperationoptionsui.lbldirectoryexists.caption
msgid "When dir&ectory exists"
msgstr "W&enn das Verzeichnis vorhanden ist"

#: tfilesystemcopymoveoperationoptionsui.lblfileexists.caption
msgid "When &file exists"
msgstr "&Wenn die Datei vorhanden ist"

#: tfilesystemcopymoveoperationoptionsui.lblsetpropertyerror.caption
msgid "When ca&nnot set property"
msgstr "We&nn Eigenschaften nicht übernommen werden können"

#: tfilesystemcopymoveoperationoptionsui.lbltemplatename.caption
msgid "<no template>"
msgstr "<Keine Vorlage>"

#: tfrmabout.btnclose.caption
msgctxt "TFRMABOUT.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "S&chließen"

#: tfrmabout.btncopytoclipboard.caption
msgid "Copy to clipboard"
msgstr "In die Zwischenablage kopieren"

#: tfrmabout.caption
msgctxt "TFRMABOUT.CAPTION"
msgid "About"
msgstr "Über"

#: tfrmabout.lblbuild.caption
msgctxt "tfrmabout.lblbuild.caption"
msgid "Build"
msgstr "Build"

#: tfrmabout.lblfreepascalver.caption
msgctxt "tfrmabout.lblfreepascalver.caption"
msgid "Free Pascal"
msgstr "Free Pascal"

#: tfrmabout.lblhomepage.caption
msgid "Home Page:"
msgstr "Homepage"

#: tfrmabout.lblhomepageaddress.caption
msgid "http://doublecmd.sourceforge.net"
msgstr "http://doublecmd.sourceforge.net"

#: tfrmabout.lbllazarusver.caption
msgctxt "tfrmabout.lbllazarusver.caption"
msgid "Lazarus"
msgstr "Lazarus"

#: tfrmabout.lblrevision.caption
msgctxt "TFRMABOUT.LBLREVISION.CAPTION"
msgid "Revision"
msgstr "Revision"

#: tfrmabout.lbltitle.caption
msgctxt "TFRMABOUT.LBLTITLE.CAPTION"
msgid "Double Commander"
msgstr "Double Commander"

#: tfrmabout.lblversion.caption
msgctxt "tfrmabout.lblversion.caption"
msgid "Version"
msgstr "Version"

#: tfrmattributesedit.btncancel.caption
msgctxt "TFRMATTRIBUTESEDIT.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "Abbru&ch"

#: tfrmattributesedit.btnok.caption
msgctxt "TFRMATTRIBUTESEDIT.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"

#: tfrmattributesedit.btnreset.caption
msgid "&Reset"
msgstr "&Zurücksetzen"

#: tfrmattributesedit.caption
msgid "Choose attributes"
msgstr "Attribute wählen"

#: tfrmattributesedit.cbarchive.caption
msgid "&Archive"
msgstr "&Archiv"

#: tfrmattributesedit.cbcompressed.caption
msgid "Co&mpressed"
msgstr "Ko&mprimiert"

#: tfrmattributesedit.cbdirectory.caption
msgid "&Directory"
msgstr "Ver&zeichnis"

#: tfrmattributesedit.cbencrypted.caption
msgid "&Encrypted"
msgstr "V&erschlüsselt"

#: tfrmattributesedit.cbhidden.caption
msgid "&Hidden"
msgstr "&Versteckt"

#: tfrmattributesedit.cbreadonly.caption
msgid "Read o&nly"
msgstr "&Schreibgeschützt"

#: tfrmattributesedit.cbsgid.caption
msgctxt "TFRMATTRIBUTESEDIT.CBSGID.CAPTION"
msgid "SGID"
msgstr "SGID"

#: tfrmattributesedit.cbsparse.caption
msgid "S&parse"
msgstr "&Kaum"

#: tfrmattributesedit.cbsticky.caption
msgctxt "TFRMATTRIBUTESEDIT.CBSTICKY.CAPTION"
msgid "Sticky"
msgstr "Dauerhaft"

#: tfrmattributesedit.cbsuid.caption
msgctxt "TFRMATTRIBUTESEDIT.CBSUID.CAPTION"
msgid "SUID"
msgstr "SUID"

#: tfrmattributesedit.cbsymlink.caption
msgid "&Symlink"
msgstr "&Symbolischer Link"

#: tfrmattributesedit.cbsystem.caption
msgctxt "TFRMATTRIBUTESEDIT.CBSYSTEM.CAPTION"
msgid "S&ystem"
msgstr "S&ystem"

#: tfrmattributesedit.cbtemporary.caption
msgid "&Temporary"
msgstr "&Temporär"

#: tfrmattributesedit.gbntfsattributes.caption
msgid "NTFS attributes"
msgstr "NTFS-Attribute"

#: tfrmattributesedit.gbwingeneral.caption
msgid "General attributes"
msgstr "Allgemeine Attribute"

#: tfrmattributesedit.lblattrbitsstr.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLATTRBITSSTR.CAPTION"
msgid "Bits:"
msgstr "Bits:"

#: tfrmattributesedit.lblattrgroupstr.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLATTRGROUPSTR.CAPTION"
msgid "Group"
msgstr "Gruppe"

#: tfrmattributesedit.lblattrotherstr.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLATTROTHERSTR.CAPTION"
msgid "Other"
msgstr "Andere"

#: tfrmattributesedit.lblattrownerstr.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLATTROWNERSTR.CAPTION"
msgid "Owner"
msgstr "Besitzer"

#: tfrmattributesedit.lblexec.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLEXEC.CAPTION"
msgid "Execute"
msgstr "Ausführen"

#: tfrmattributesedit.lblread.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLREAD.CAPTION"
msgid "Read"
msgstr "Lesen"

#: tfrmattributesedit.lbltextattrs.caption
msgid "As te&xt:"
msgstr "Als Te&xt:"

#: tfrmattributesedit.lblwrite.caption
msgctxt "TFRMATTRIBUTESEDIT.LBLWRITE.CAPTION"
msgid "Write"
msgstr "Schreiben"

#: tfrmchecksumcalc.caption
msgctxt "tfrmchecksumcalc.caption"
msgid "Calculate checksum..."
msgstr "Berechne Prüfsumme..."

#: tfrmchecksumcalc.cbopenafterjobiscomplete.caption
msgid "Open checksum file after job is completed"
msgstr "Prüfsummen-Datei öffnen nachdem der Job beendet ist"

#: tfrmchecksumcalc.cbseparatefile.caption
msgid "C&reate separate checksum file for each file"
msgstr "Fü&r jede Datei eigene Prüfdatei erstellen"

#: tfrmchecksumcalc.lblsaveto.caption
msgid "&Save checksum file(s) to:"
msgstr "Prüf&summen-Datei speichern unter:"

#: tfrmchecksumverify.btnclose.caption
msgctxt "TFRMCHECKSUMVERIFY.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "S&chließen"

#: tfrmchecksumverify.caption
msgctxt "TFRMCHECKSUMVERIFY.CAPTION"
msgid "Verify checksum..."
msgstr "Verifiziere Prüfsumme..."

#: tfrmconnectionmanager.btnadd.caption
msgctxt "TFRMCONNECTIONMANAGER.BTNADD.CAPTION"
msgid "A&dd"
msgstr "&Hinzufügen"

#: tfrmconnectionmanager.btncancel.caption
msgctxt "TFRMCONNECTIONMANAGER.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Abbrechen"

#: tfrmconnectionmanager.btnconnect.caption
msgid "C&onnect"
msgstr "Ve&rbinden"

#: tfrmconnectionmanager.btndelete.caption
msgctxt "tfrmconnectionmanager.btndelete.caption"
msgid "&Delete"
msgstr "&Löschen"

#: tfrmconnectionmanager.btnedit.caption
msgctxt "TFRMCONNECTIONMANAGER.BTNEDIT.CAPTION"
msgid "&Edit"
msgstr "Bearb&eiten"

#: tfrmconnectionmanager.caption
msgid "Connection manager"
msgstr "Verbindungsmanager"

#: tfrmconnectionmanager.gbconnectto.caption
msgid "Connect to:"
msgstr "Verbinde mit:"

#: tfrmcopydlg.btnaddtoqueue.caption
msgid "A&dd To Queue"
msgstr "&Zur Warteschlange hinzufügen"

#: tfrmcopydlg.btncancel.caption
msgctxt "TFRMCOPYDLG.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Abbrechen"

#: tfrmcopydlg.btnoptions.caption
msgid "O&ptions"
msgstr "O&ptionen"

#: tfrmcopydlg.btnsaveoptions.caption
msgid "Sa&ve these options as default"
msgstr "Diese &Optionen als Standard speichern"

#: tfrmcopydlg.caption
msgctxt "TFRMCOPYDLG.CAPTION"
msgid "Copy file(s)"
msgstr "Datei(en) kopieren"

#: tfrmcopydlg.mnunewqueue.caption
msgid "New queue"
msgstr "Neue Warteschlange"

#: tfrmcopydlg.mnuqueue1.caption
msgctxt "tfrmcopydlg.mnuqueue1.caption"
msgid "Queue 1"
msgstr "Warteschlange 1"

#: tfrmcopydlg.mnuqueue2.caption
msgctxt "tfrmcopydlg.mnuqueue2.caption"
msgid "Queue 2"
msgstr "Warteschlange 2"

#: tfrmcopydlg.mnuqueue3.caption
msgctxt "tfrmcopydlg.mnuqueue3.caption"
msgid "Queue 3"
msgstr "Warteschlange 3"

#: tfrmcopydlg.mnuqueue4.caption
msgctxt "tfrmcopydlg.mnuqueue4.caption"
msgid "Queue 4"
msgstr "Warteschlange 4"

#: tfrmcopydlg.mnuqueue5.caption
msgctxt "tfrmcopydlg.mnuqueue5.caption"
msgid "Queue 5"
msgstr "Warteschlange 5"

#: tfrmdescredit.actsavedescription.caption
msgid "Save Description"
msgstr "Beschreibung speichern"

#: tfrmdescredit.btncancel.caption
msgctxt "TFRMDESCREDIT.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Abbrechen"

#: tfrmdescredit.btnok.caption
msgctxt "TFRMDESCREDIT.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"

#: tfrmdescredit.caption
msgid "File/folder comment"
msgstr "Datei- / Ordnerkommentar"

#: tfrmdescredit.lbleditcommentfor.caption
msgid "E&dit comment for:"
msgstr "&Bearbeite Kommentar für:"

#: tfrmdescredit.lblencoding.caption
msgctxt "TFRMDESCREDIT.LBLENCODING.CAPTION"
msgid "&Encoding:"
msgstr "&Kodierung:"

#: tfrmdescredit.lblfilename.caption
msgctxt "TFRMDESCREDIT.LBLFILENAME.CAPTION"
msgid "???"
msgstr "???"

#: tfrmdiffer.actabout.caption
msgctxt "TFRMDIFFER.ACTABOUT.CAPTION"
msgid "About"
msgstr "&Über"

#: tfrmdiffer.actautocompare.caption
msgid "Auto Compare"
msgstr "Automatisch vergleichen"

#: tfrmdiffer.actbinarycompare.caption
msgid "Binary Mode"
msgstr "Binärer Modus"

#: tfrmdiffer.actcancelcompare.caption
msgctxt "TFRMDIFFER.ACTCANCELCOMPARE.CAPTION"
msgid "Cancel"
msgstr "Abbrechen"

#: tfrmdiffer.actcancelcompare.hint
msgctxt "TFRMDIFFER.ACTCANCELCOMPARE.HINT"
msgid "Cancel"
msgstr "Abbrechen"

#: tfrmdiffer.actcopylefttoright.caption
msgctxt "TFRMDIFFER.ACTCOPYLEFTTORIGHT.CAPTION"
msgid "Copy Block Right"
msgstr "Block nach rechts kopieren"

#: tfrmdiffer.actcopylefttoright.hint
msgctxt "TFRMDIFFER.ACTCOPYLEFTTORIGHT.HINT"
msgid "Copy Block Right"
msgstr "Block nach rechts kopieren"

#: tfrmdiffer.actcopyrighttoleft.caption
msgctxt "TFRMDIFFER.ACTCOPYRIGHTTOLEFT.CAPTION"
msgid "Copy Block Left"
msgstr "Block nach links kopieren"

#: tfrmdiffer.actcopyrighttoleft.hint
msgctxt "TFRMDIFFER.ACTCOPYRIGHTTOLEFT.HINT"
msgid "Copy Block Left"
msgstr "Block nach links kopieren"

#: tfrmdiffer.acteditcopy.caption
msgctxt "TFRMDIFFER.ACTEDITCOPY.CAPTION"
msgid "Copy"
msgstr "Kopieren"

#: tfrmdiffer.acteditcut.caption
msgctxt "TFRMDIFFER.ACTEDITCUT.CAPTION"
msgid "Cut"
msgstr "Ausschneiden"

#: tfrmdiffer.acteditdelete.caption
msgctxt "TFRMDIFFER.ACTEDITDELETE.CAPTION"
msgid "Delete"
msgstr "&Löschen"

#: tfrmdiffer.acteditpaste.caption
msgctxt "TFRMDIFFER.ACTEDITPASTE.CAPTION"
msgid "Paste"
msgstr "Einfügen"

#: tfrmdiffer.acteditredo.caption
msgctxt "TFRMDIFFER.ACTEDITREDO.CAPTION"
msgid "Redo"
msgstr "Wiederholen"

#: tfrmdiffer.acteditselectall.caption
msgid "Select &All"
msgstr "&Alles markieren"

#: tfrmdiffer.acteditundo.caption
msgctxt "TFRMDIFFER.ACTEDITUNDO.CAPTION"
msgid "Undo"
msgstr "Rückgängig machen"

#: tfrmdiffer.actexit.caption
msgctxt "tfrmdiffer.actexit.caption"
msgid "E&xit"
msgstr "&Beenden"

#: tfrmdiffer.actfirstdifference.caption
msgctxt "tfrmdiffer.actfirstdifference.caption"
msgid "First Difference"
msgstr "Erster Unterschied"

#: tfrmdiffer.actfirstdifference.hint
msgctxt "tfrmdiffer.actfirstdifference.hint"
msgid "First Difference"
msgstr "Erster Unterschied"

#: tfrmdiffer.actignorecase.caption
msgid "Ignore Case"
msgstr "Groß-/Kleinschreibung ignorieren"

#: tfrmdiffer.actignorewhitespace.caption
msgid "Ignore Blanks"
msgstr "Leerzeichen ignorieren"

#: tfrmdiffer.actkeepscrolling.caption
msgid "Keep Scrolling"
msgstr "Bildlauf fortsetzen"

#: tfrmdiffer.actlastdifference.caption
msgctxt "tfrmdiffer.actlastdifference.caption"
msgid "Last Difference"
msgstr "Letzter Unterschied"

#: tfrmdiffer.actlastdifference.hint
msgctxt "tfrmdiffer.actlastdifference.hint"
msgid "Last Difference"
msgstr "Letzter Unterschied"

#: tfrmdiffer.actlinedifferences.caption
msgid "Line Differences"
msgstr "Zeilenunterschied"

#: tfrmdiffer.actnextdifference.caption
msgctxt "tfrmdiffer.actnextdifference.caption"
msgid "Next Difference"
msgstr "Nächster Unterschied"

#: tfrmdiffer.actnextdifference.hint
msgctxt "tfrmdiffer.actnextdifference.hint"
msgid "Next Difference"
msgstr "Nächster Unterschied"

#: tfrmdiffer.actopenleft.caption
msgid "Open Left..."
msgstr "Öffne links..."

#: tfrmdiffer.actopenright.caption
msgid "Open Right..."
msgstr "Öffne rechts..."

#: tfrmdiffer.actpaintbackground.caption
msgid "Paint Background"
msgstr "Hintergrund zeichnen"

#: tfrmdiffer.actprevdifference.caption
msgctxt "tfrmdiffer.actprevdifference.caption"
msgid "Previous Difference"
msgstr "Vorheriger Unterschied"

#: tfrmdiffer.actprevdifference.hint
msgctxt "tfrmdiffer.actprevdifference.hint"
msgid "Previous Difference"
msgstr "Vorheriger Unterschied"

#: tfrmdiffer.actreload.caption
msgid "&Reload"
msgstr "&Neu laden"

#: tfrmdiffer.actreload.hint
msgctxt "TFRMDIFFER.ACTRELOAD.HINT"
msgid "Reload"
msgstr "Neu laden"

#: tfrmdiffer.actsave.caption
msgctxt "TFRMDIFFER.ACTSAVE.CAPTION"
msgid "Save"
msgstr "Speichern"

#: tfrmdiffer.actsave.hint
msgctxt "TFRMDIFFER.ACTSAVE.HINT"
msgid "Save"
msgstr "Speichern"

#: tfrmdiffer.actsaveas.caption
msgctxt "TFRMDIFFER.ACTSAVEAS.CAPTION"
msgid "Save as..."
msgstr "Speichern unter..."

#: tfrmdiffer.actsaveas.hint
msgctxt "TFRMDIFFER.ACTSAVEAS.HINT"
msgid "Save as..."
msgstr "Speichern unter..."

#: tfrmdiffer.actsaveleft.caption
msgctxt "TFRMDIFFER.ACTSAVELEFT.CAPTION"
msgid "Save Left"
msgstr "Speichere links"

#: tfrmdiffer.actsaveleft.hint
msgctxt "TFRMDIFFER.ACTSAVELEFT.HINT"
msgid "Save Left"
msgstr "Speichere links"

#: tfrmdiffer.actsaveleftas.caption
msgctxt "TFRMDIFFER.ACTSAVELEFTAS.CAPTION"
msgid "Save Left As..."
msgstr "Speichere links unter..."

#: tfrmdiffer.actsaveleftas.hint
msgctxt "TFRMDIFFER.ACTSAVELEFTAS.HINT"
msgid "Save Left As..."
msgstr "Speichere links unter..."

#: tfrmdiffer.actsaveright.caption
msgctxt "TFRMDIFFER.ACTSAVERIGHT.CAPTION"
msgid "Save Right"
msgstr "Speichere rechts"

#: tfrmdiffer.actsaveright.hint
msgctxt "TFRMDIFFER.ACTSAVERIGHT.HINT"
msgid "Save Right"
msgstr "Speichere rechts"

#: tfrmdiffer.actsaverightas.caption
msgctxt "TFRMDIFFER.ACTSAVERIGHTAS.CAPTION"
msgid "Save Right As..."
msgstr "Speichere rechts unter..."

#: tfrmdiffer.actsaverightas.hint
msgctxt "TFRMDIFFER.ACTSAVERIGHTAS.HINT"
msgid "Save Right As..."
msgstr "Speichere rechts unter..."

#: tfrmdiffer.actstartcompare.caption
msgctxt "TFRMDIFFER.ACTSTARTCOMPARE.CAPTION"
msgid "Compare"
msgstr "Vergleiche"

#: tfrmdiffer.actstartcompare.hint
msgctxt "TFRMDIFFER.ACTSTARTCOMPARE.HINT"
msgid "Compare"
msgstr "Vergleiche"

#: tfrmdiffer.btnleftencoding.hint
msgctxt "TFRMDIFFER.BTNLEFTENCODING.HINT"
msgid "Encoding"
msgstr "Kodierung"

#: tfrmdiffer.btnrightencoding.hint
msgctxt "TFRMDIFFER.BTNRIGHTENCODING.HINT"
msgid "Encoding"
msgstr "Kodierung"

#: tfrmdiffer.caption
msgctxt "TFRMDIFFER.CAPTION"
msgid "Compare files"
msgstr "Vergleiche Dateien"

#: tfrmdiffer.midivider1.caption
msgctxt "TFRMDIFFER.MIDIVIDER1.CAPTION"
msgid "-"
msgstr "-"

#: tfrmdiffer.midivider10.caption
msgctxt "TFRMDIFFER.MIDIVIDER10.CAPTION"
msgid "-"
msgstr "-"

#: tfrmdiffer.midivider2.caption
msgctxt "TFRMDIFFER.MIDIVIDER2.CAPTION"
msgid "-"
msgstr "-"

#: tfrmdiffer.midivider3.caption
msgctxt "TFRMDIFFER.MIDIVIDER3.CAPTION"
msgid "-"
msgstr "-"

#: tfrmdiffer.midivider4.caption
msgctxt "TFRMDIFFER.MIDIVIDER4.CAPTION"
msgid "-"
msgstr "-"

#: tfrmdiffer.midivider5.caption
msgctxt "TFRMDIFFER.MIDIVIDER5.CAPTION"
msgid "-"
msgstr "-"

#: tfrmdiffer.midivider6.caption
msgctxt "TFRMDIFFER.MIDIVIDER6.CAPTION"
msgid "-"
msgstr "-"

#: tfrmdiffer.midivider7.caption
msgctxt "TFRMDIFFER.MIDIVIDER7.CAPTION"
msgid "-"
msgstr "-"

#: tfrmdiffer.midivider8.caption
msgctxt "TFRMDIFFER.MIDIVIDER8.CAPTION"
msgid "-"
msgstr "-"

#: tfrmdiffer.midivider9.caption
msgctxt "TFRMDIFFER.MIDIVIDER9.CAPTION"
msgid "-"
msgstr "-"

#: tfrmdiffer.miencodingleft.caption
msgid "&Left"
msgstr "&Links"

#: tfrmdiffer.miencodingright.caption
msgid "&Right"
msgstr "&Rechts"

#: tfrmdiffer.miseparator1.caption
msgctxt "TFRMDIFFER.MISEPARATOR1.CAPTION"
msgid "-"
msgstr "-"

#: tfrmdiffer.miseparator2.caption
msgctxt "TFRMDIFFER.MISEPARATOR2.CAPTION"
msgid "-"
msgstr "-"

#: tfrmdiffer.mnuactions.caption
msgid "&Actions"
msgstr "&Aktionen"

#: tfrmdiffer.mnuedit.caption
msgctxt "TFRMDIFFER.MNUEDIT.CAPTION"
msgid "&Edit"
msgstr "Bea&rbeiten"

#: tfrmdiffer.mnuencoding.caption
msgctxt "tfrmdiffer.mnuencoding.caption"
msgid "En&coding"
msgstr "&Kodierung"

#: tfrmdiffer.mnufile.caption
msgctxt "tfrmdiffer.mnufile.caption"
msgid "&File"
msgstr "&Datei"

#: tfrmdiffer.mnuoptions.caption
msgid "&Options"
msgstr "&Optionen"

#: tfrmedithotkey.btnaddshortcut.hint
msgid "Add new shortcut to sequence"
msgstr "Neue Verknüpfung zur Sequenz hinzufügen"

#: tfrmedithotkey.btncancel.caption
msgctxt "TFRMEDITHOTKEY.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "Abbru&ch"

#: tfrmedithotkey.btnok.caption
msgctxt "TFRMEDITHOTKEY.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"

#: tfrmedithotkey.btnremoveshortcut.hint
msgid "Remove last shortcut from sequence"
msgstr "Letzte Verknüpfung aus der Sequenz entfernen"

#: tfrmedithotkey.btnselectfromlist.hint
msgid "Select shortcut from list of remaining free available keys"
msgstr ""

#: tfrmedithotkey.cghkcontrols.caption
msgctxt "tfrmedithotkey.cghkcontrols.caption"
msgid "Only for these controls"
msgstr "Nur für diese Steuerungselemente"

#: tfrmedithotkey.lblparameters.caption
msgid "&Parameters (each in a separate line):"
msgstr "&Parameter (jeder in einer eigenen Zeile):"

#: tfrmedithotkey.lblshortcuts.caption
msgid "Shortcuts:"
msgstr "Verknüpfungen:"

#: tfrmeditor.actabout.caption
msgctxt "TFRMEDITOR.ACTABOUT.CAPTION"
msgid "About"
msgstr "&Über"

#: tfrmeditor.actabout.hint
msgctxt "tfrmeditor.actabout.hint"
msgid "About"
msgstr "&Über"

#: tfrmeditor.actconfhigh.caption
msgid "&Configuration"
msgstr "&Einstellungen"

#: tfrmeditor.actconfhigh.hint
msgctxt "tfrmeditor.actconfhigh.hint"
msgid "Configuration"
msgstr "Einstellungen"

#: tfrmeditor.acteditcopy.caption
msgctxt "TFRMEDITOR.ACTEDITCOPY.CAPTION"
msgid "Copy"
msgstr "Kopieren"

#: tfrmeditor.acteditcopy.hint
msgctxt "tfrmeditor.acteditcopy.hint"
msgid "Copy"
msgstr "Kopieren"

#: tfrmeditor.acteditcut.caption
msgctxt "TFRMEDITOR.ACTEDITCUT.CAPTION"
msgid "Cut"
msgstr "Ausschneiden"

#: tfrmeditor.acteditcut.hint
msgctxt "tfrmeditor.acteditcut.hint"
msgid "Cut"
msgstr "Ausschneiden"

#: tfrmeditor.acteditdelete.caption
msgctxt "TFRMEDITOR.ACTEDITDELETE.CAPTION"
msgid "Delete"
msgstr "&Löschen"

#: tfrmeditor.acteditdelete.hint
msgctxt "tfrmeditor.acteditdelete.hint"
msgid "Delete"
msgstr "&Löschen"

#: tfrmeditor.acteditfind.caption
msgctxt "tfrmeditor.acteditfind.caption"
msgid "&Find"
msgstr "&Suchen"

#: tfrmeditor.acteditfind.hint
msgctxt "tfrmeditor.acteditfind.hint"
msgid "Find"
msgstr "Suchen"

#: tfrmeditor.acteditfindnext.caption
msgctxt "tfrmeditor.acteditfindnext.caption"
msgid "Find next"
msgstr "Finde nächste"

#: tfrmeditor.acteditfindnext.hint
msgctxt "tfrmeditor.acteditfindnext.hint"
msgid "Find next"
msgstr "Finde nächste"

#: tfrmeditor.acteditfindprevious.caption
msgctxt "tfrmeditor.acteditfindprevious.caption"
msgid "Find previous"
msgstr "Finde vorherige"

#: tfrmeditor.acteditgotoline.caption
msgctxt "tfrmeditor.acteditgotoline.caption"
msgid "Goto Line..."
msgstr "Gehe zu Zeile..."

#: tfrmeditor.acteditlineendcr.caption
msgctxt "tfrmeditor.acteditlineendcr.caption"
msgid "Mac (CR)"
msgstr "Mac (CR)"

#: tfrmeditor.acteditlineendcr.hint
msgctxt "tfrmeditor.acteditlineendcr.hint"
msgid "Mac (CR)"
msgstr "Mac (CR)"

#: tfrmeditor.acteditlineendcrlf.caption
msgctxt "tfrmeditor.acteditlineendcrlf.caption"
msgid "Windows (CRLF)"
msgstr "Windows (CRLF)"

#: tfrmeditor.acteditlineendcrlf.hint
msgctxt "tfrmeditor.acteditlineendcrlf.hint"
msgid "Windows (CRLF)"
msgstr "Windows (CRLF)"

#: tfrmeditor.acteditlineendlf.caption
msgctxt "tfrmeditor.acteditlineendlf.caption"
msgid "Unix (LF)"
msgstr "Unix (LF)"

#: tfrmeditor.acteditlineendlf.hint
msgctxt "tfrmeditor.acteditlineendlf.hint"
msgid "Unix (LF)"
msgstr "Unix (LF)"

#: tfrmeditor.acteditpaste.caption
msgctxt "TFRMEDITOR.ACTEDITPASTE.CAPTION"
msgid "Paste"
msgstr "Einfügen"

#: tfrmeditor.acteditpaste.hint
msgctxt "tfrmeditor.acteditpaste.hint"
msgid "Paste"
msgstr "Einfügen"

#: tfrmeditor.acteditredo.caption
msgctxt "TFRMEDITOR.ACTEDITREDO.CAPTION"
msgid "Redo"
msgstr "Wiederholen"

#: tfrmeditor.acteditredo.hint
msgctxt "tfrmeditor.acteditredo.hint"
msgid "Redo"
msgstr "Wiederholen"

#: tfrmeditor.acteditrplc.caption
msgid "&Replace"
msgstr "E&rsetzen"

#: tfrmeditor.acteditrplc.hint
msgctxt "tfrmeditor.acteditrplc.hint"
msgid "Replace"
msgstr "Ersetzen"

#: tfrmeditor.acteditselectall.caption
msgid "Select&All"
msgstr "&Alle markieren"

#: tfrmeditor.acteditselectall.hint
msgctxt "tfrmeditor.acteditselectall.hint"
msgid "Select All"
msgstr "Alle mar&kieren"

#: tfrmeditor.acteditundo.caption
msgctxt "TFRMEDITOR.ACTEDITUNDO.CAPTION"
msgid "Undo"
msgstr "Rückgängig machen"

#: tfrmeditor.acteditundo.hint
msgctxt "tfrmeditor.acteditundo.hint"
msgid "Undo"
msgstr "Rückgängig machen"

#: tfrmeditor.actfileclose.caption
msgctxt "TFRMEDITOR.ACTFILECLOSE.CAPTION"
msgid "&Close"
msgstr "S&chließen"

#: tfrmeditor.actfileclose.hint
msgctxt "tfrmeditor.actfileclose.hint"
msgid "Close"
msgstr "Schließen"

#: tfrmeditor.actfileexit.caption
msgctxt "TFRMEDITOR.ACTFILEEXIT.CAPTION"
msgid "E&xit"
msgstr "&Beenden"

#: tfrmeditor.actfileexit.hint
msgctxt "tfrmeditor.actfileexit.hint"
msgid "Exit"
msgstr "Programm beenden"

#: tfrmeditor.actfilenew.caption
msgctxt "TFRMEDITOR.ACTFILENEW.CAPTION"
msgid "&New"
msgstr "&Neu"

#: tfrmeditor.actfilenew.hint
msgctxt "tfrmeditor.actfilenew.hint"
msgid "New"
msgstr "Neu"

#: tfrmeditor.actfileopen.caption
msgid "&Open"
msgstr "&Öffnen"

#: tfrmeditor.actfileopen.hint
msgctxt "tfrmeditor.actfileopen.hint"
msgid "Open"
msgstr "Öffnen"

#: tfrmeditor.actfilesave.caption
msgctxt "TFRMEDITOR.ACTFILESAVE.CAPTION"
msgid "&Save"
msgstr "&Speichern"

#: tfrmeditor.actfilesave.hint
msgctxt "tfrmeditor.actfilesave.hint"
msgid "Save"
msgstr "Speichern"

#: tfrmeditor.actfilesaveas.caption
msgid "Save &As..."
msgstr "Speichern &unter..."

#: tfrmeditor.actfilesaveas.hint
msgid "Save As"
msgstr "Speichern unter..."

#: tfrmeditor.actsaveall.caption
msgid "Sa&ve All"
msgstr "Alles &speichern"

#: tfrmeditor.actsaveall.hint
msgid "Save All"
msgstr "Alle speichern"

#: tfrmeditor.caption
msgctxt "tfrmeditor.caption"
msgid "Editor"
msgstr "Text-Editor"

#: tfrmeditor.help1.caption
msgctxt "TFRMEDITOR.HELP1.CAPTION"
msgid "&Help"
msgstr "&Hilfe"

#: tfrmeditor.menuitem1.caption
msgctxt "tfrmeditor.menuitem1.caption"
msgid "-"
msgstr "-"

#: tfrmeditor.midiv.caption
msgctxt "TFRMEDITOR.MIDIV.CAPTION"
msgid "-"
msgstr "-"

#: tfrmeditor.miedit.caption
msgctxt "TFRMEDITOR.MIEDIT.CAPTION"
msgid "&Edit"
msgstr "&Bearbeiten"

#: tfrmeditor.miencoding.caption
msgctxt "TFRMEDITOR.MIENCODING.CAPTION"
msgid "En&coding"
msgstr "&Kodierung"

#: tfrmeditor.miencodingin.caption
msgid "Open as"
msgstr "Öffnen als..."

#: tfrmeditor.miencodingout.caption
msgctxt "tfrmeditor.miencodingout.caption"
msgid "Save as"
msgstr "Speichern unter..."

#: tfrmeditor.mifile.caption
msgctxt "TFRMEDITOR.MIFILE.CAPTION"
msgid "&File"
msgstr "&Datei"

#: tfrmeditor.mihighlight.caption
msgid "Syntax highlight"
msgstr "S&yntaxhervorhebung"

#: tfrmeditor.milineendtype.caption
msgid "End Of Line"
msgstr "Zeilenende"

#: tfrmeditor.miseparator1.caption
msgctxt "TFRMEDITOR.MISEPARATOR1.CAPTION"
msgid "-"
msgstr "-"

#: tfrmeditor.miseparator2.caption
msgctxt "TFRMEDITOR.MISEPARATOR2.CAPTION"
msgid "-"
msgstr "-"

#: tfrmeditor.n1.caption
msgctxt "TFRMEDITOR.N1.CAPTION"
msgid "-"
msgstr "-"

#: tfrmeditor.n3.caption
msgctxt "TFRMEDITOR.N3.CAPTION"
msgid "-"
msgstr "-"

#: tfrmeditor.n4.caption
msgctxt "TFRMEDITOR.N4.CAPTION"
msgid "-"
msgstr "-"

#: tfrmeditor.n5.caption
msgctxt "TFRMEDITOR.N5.CAPTION"
msgid "-"
msgstr "-"

#: tfrmeditsearchreplace.buttonpanel.cancelbutton.caption
#, fuzzy
msgctxt "tfrmeditsearchreplace.buttonpanel.cancelbutton.caption"
msgid "&Cancel"
msgstr "&Ende"

#: tfrmeditsearchreplace.buttonpanel.okbutton.caption
#, fuzzy
msgctxt "tfrmeditsearchreplace.buttonpanel.okbutton.caption"
msgid "&OK"
msgstr "&OK"

#: tfrmeditsearchreplace.cbsearchcasesensitive.caption
msgid "C&ase sensitivity"
msgstr "Groß/Kleins&chreibung"

#: tfrmeditsearchreplace.cbsearchfromcursor.caption
msgid "S&earch from caret"
msgstr "Suche von &Cursor"

#: tfrmeditsearchreplace.cbsearchregexp.caption
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHREGEXP.CAPTION"
msgid "&Regular expressions"
msgstr "&Reguläre Ausdrücke"

#: tfrmeditsearchreplace.cbsearchselectedonly.caption
msgid "Selected &text only"
msgstr "Nur den markierten &Text"

#: tfrmeditsearchreplace.cbsearchwholewords.caption
msgid "&Whole words only"
msgstr "Nur ganze &Worte"

#: tfrmeditsearchreplace.gbsearchoptions.caption
msgid "Option"
msgstr "Optionen"

#: tfrmeditsearchreplace.lblreplacewith.caption
msgid "&Replace with:"
msgstr "&Ersetzen mit:"

#: tfrmeditsearchreplace.lblsearchfor.caption
msgid "&Search for:"
msgstr "&Suche nach:"

#: tfrmeditsearchreplace.rgsearchdirection.caption
msgid "Direction"
msgstr "Richtung"

#: tfrmextractdlg.caption
msgctxt "TFRMEXTRACTDLG.CAPTION"
msgid "Unpack files"
msgstr "Entpacke Dateien"

#: tfrmextractdlg.cbextractpath.caption
msgid "&Unpack path names if stored with files"
msgstr "&Pfad mit entpacken (falls gespeichert)"

#: tfrmextractdlg.cbfilemask.text
msgctxt "tfrmextractdlg.cbfilemask.text"
msgid "*.*"
msgstr "*.*"

#: tfrmextractdlg.cbinseparatefolder.caption
msgid "Unpack each archive to a &separate subdir (name of the archive)"
msgstr "Jedes Archiv in &separaten Ordner entpacken (mit Namen des Archivs)"

#: tfrmextractdlg.cboverwrite.caption
msgid "O&verwrite existing files"
msgstr "&Vorhandene Dateien überschreiben"

#: tfrmextractdlg.lblextractto.caption
msgid "To the &directory:"
msgstr "Entpacke Dateien &nach"

#: tfrmextractdlg.lblfilemask.caption
msgid "&Extract files matching file mask:"
msgstr "Entpacke &Dateien anhand Auswahl"

#: tfrmextractdlg.lblpassword.caption
msgid "&Password for encrypted files:"
msgstr "&Passwort für verschlüsselte Dateien"

#: tfrmfileexecuteyourself.btnclose.caption
msgctxt "TFRMFILEEXECUTEYOURSELF.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "S&chließen"

#: tfrmfileexecuteyourself.caption
msgctxt "TFRMFILEEXECUTEYOURSELF.CAPTION"
msgid "Wait..."
msgstr "Warte..."

#: tfrmfileexecuteyourself.lblfilename.caption
msgid "File name:"
msgstr "Dateiname:"

#: tfrmfileexecuteyourself.lblfrompath.caption
msgctxt "TFRMFILEEXECUTEYOURSELF.LBLFROMPATH.CAPTION"
msgid "From:"
msgstr "Von:"

#: tfrmfileexecuteyourself.lblprompt.caption
msgid "Click on Close when the temporary file can be deleted!"
msgstr "Auf [Schließen] klicken, wenn die temporären Daten gelöscht werden können!"

#: tfrmfileop.btncancel.caption
msgctxt "TFRMFILEOP.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Abbrechen"

#: tfrmfileop.btnminimizetopanel.caption
msgid "&To panel"
msgstr "&In Panel:"

#: tfrmfileop.btnviewoperations.caption
msgid "&View all"
msgstr "&Alle betrachten"

#: tfrmfileop.lblcurrentoperation.caption
msgid "Current operation:"
msgstr "Aktuelle Operation:"

#: tfrmfileop.lblfrom.caption
msgctxt "TFRMFILEOP.LBLFROM.CAPTION"
msgid "From:"
msgstr "Von:"

#: tfrmfileop.lblto.caption
msgid "To:"
msgstr "Nach:"

#: tfrmfileproperties.btnclose.caption
msgctxt "tfrmfileproperties.btnclose.caption"
msgid "&Close"
msgstr "S&chließen"

#: tfrmfileproperties.btnsetproperties.caption
msgid "&Set properties"
msgstr "Eigen&schaften einstellen"

#: tfrmfileproperties.btnsetpropertiestoallfiles.caption
msgid "Set to &all selected files"
msgstr "&Auf ausgewählte Dateien anwenden"

#: tfrmfileproperties.btnskipfile.caption
msgid "Ski&p this file"
msgstr "Diese Datei übers&pringen"

#: tfrmfileproperties.caption
msgctxt "TFRMFILEPROPERTIES.CAPTION"
msgid "Properties"
msgstr "Eigenschaften"

#: tfrmfileproperties.cbsgid.caption
msgctxt "TFRMFILEPROPERTIES.CBSGID.CAPTION"
msgid "SGID"
msgstr "SGID"

#: tfrmfileproperties.cbsticky.caption
msgctxt "TFRMFILEPROPERTIES.CBSTICKY.CAPTION"
msgid "Sticky"
msgstr "Dauerhaft"

#: tfrmfileproperties.cbsuid.caption
msgctxt "TFRMFILEPROPERTIES.CBSUID.CAPTION"
msgid "SUID"
msgstr "SUID"

#: tfrmfileproperties.chkexecutable.caption
msgid "Allow &executing file as program"
msgstr "als Programm ausführen &erlauben"

#: tfrmfileproperties.gbowner.caption
msgctxt "TFRMFILEPROPERTIES.GBOWNER.CAPTION"
msgid "Owner"
msgstr "Besitzer"

#: tfrmfileproperties.lblattrbitsstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTRBITSSTR.CAPTION"
msgid "Bits:"
msgstr "Bits:"

#: tfrmfileproperties.lblattrgroupstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION"
msgid "Group"
msgstr "Gruppe"

#: tfrmfileproperties.lblattrotherstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTROTHERSTR.CAPTION"
msgid "Other"
msgstr "Andere"

#: tfrmfileproperties.lblattrownerstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTROWNERSTR.CAPTION"
msgid "Owner"
msgstr "Besitzer"

#: tfrmfileproperties.lblattrtext.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTRTEXT.CAPTION"
msgid "-----------"
msgstr "-----------"

#: tfrmfileproperties.lblattrtextstr.caption
msgctxt "tfrmfileproperties.lblattrtextstr.caption"
msgid "Text:"
msgstr "Text:"

#: tfrmfileproperties.lblcontains.caption
msgctxt "tfrmfileproperties.lblcontains.caption"
msgid "???"
msgstr "???"

#: tfrmfileproperties.lblcontainsstr.caption
msgid "Contains:"
msgstr "Enthält:"

#: tfrmfileproperties.lblexec.caption
msgctxt "TFRMFILEPROPERTIES.LBLEXEC.CAPTION"
msgid "Execute"
msgstr "Ausführen"

#: tfrmfileproperties.lblexecutable.caption
msgid "Execute:"
msgstr "Ausführen:"

#: tfrmfileproperties.lblfile.caption
msgctxt "TFRMFILEPROPERTIES.LBLFILE.CAPTION"
msgid "File name"
msgstr "Dateiname"

#: tfrmfileproperties.lblfilename.caption
msgctxt "TFRMFILEPROPERTIES.LBLFILENAME.CAPTION"
msgid "???"
msgstr "???"

#: tfrmfileproperties.lblfilestr.caption
msgctxt "TFRMFILEPROPERTIES.LBLFILESTR.CAPTION"
msgid "File name"
msgstr "Dateiname"

#: tfrmfileproperties.lblfolder.caption
msgctxt "TFRMFILEPROPERTIES.LBLFOLDER.CAPTION"
msgid "???"
msgstr "???"

#: tfrmfileproperties.lblfolderstr.caption
msgctxt "tfrmfileproperties.lblfolderstr.caption"
msgid "Path:"
msgstr "Pfad:"

#: tfrmfileproperties.lblgroupstr.caption
msgid "&Group"
msgstr "&Gruppe"

#: tfrmfileproperties.lbllastaccess.caption
msgctxt "TFRMFILEPROPERTIES.LBLLASTACCESS.CAPTION"
msgid "???"
msgstr "???"

#: tfrmfileproperties.lbllastaccessstr.caption
msgid "Last access:"
msgstr "Letzter Zugriff"

#: tfrmfileproperties.lbllastmodif.caption
msgctxt "TFRMFILEPROPERTIES.LBLLASTMODIF.CAPTION"
msgid "???"
msgstr "???"

#: tfrmfileproperties.lbllastmodifstr.caption
msgid "Last modification:"
msgstr "Letzte Änderung:"

#: tfrmfileproperties.lbllaststchange.caption
msgctxt "TFRMFILEPROPERTIES.LBLLASTSTCHANGE.CAPTION"
msgid "???"
msgstr "???"

#: tfrmfileproperties.lbllaststchangestr.caption
msgid "Last status change:"
msgstr "Letzte Statusänderung:"

#: tfrmfileproperties.lbloctal.caption
msgctxt "TFRMFILEPROPERTIES.LBLOCTAL.CAPTION"
msgid "Octal:"
msgstr "Oktal:"

#: tfrmfileproperties.lblownerstr.caption
msgid "O&wner"
msgstr "Besit&zer"

#: tfrmfileproperties.lblread.caption
msgctxt "TFRMFILEPROPERTIES.LBLREAD.CAPTION"
msgid "Read"
msgstr "Lesen"

#: tfrmfileproperties.lblsize.caption
msgctxt "TFRMFILEPROPERTIES.LBLSIZE.CAPTION"
msgid "???"
msgstr "???"

#: tfrmfileproperties.lblsizestr.caption
msgctxt "TFRMFILEPROPERTIES.LBLSIZESTR.CAPTION"
msgid "Size:"
msgstr "Größe:"

#: tfrmfileproperties.lblsymlink.caption
msgctxt "TFRMFILEPROPERTIES.LBLSYMLINK.CAPTION"
msgid "???"
msgstr "???"

#: tfrmfileproperties.lblsymlinkstr.caption
msgid "Symlink to:"
msgstr "Symb. Link:"

#: tfrmfileproperties.lbltype.caption
msgctxt "TFRMFILEPROPERTIES.LBLTYPE.CAPTION"
msgid "???"
msgstr "???"

#: tfrmfileproperties.lbltypestr.caption
msgid "Type:"
msgstr "Typ:"

#: tfrmfileproperties.lblwrite.caption
msgctxt "TFRMFILEPROPERTIES.LBLWRITE.CAPTION"
msgid "Write"
msgstr "Schreiben"

#: tfrmfileproperties.sgimage.columns[0].title.caption
#, fuzzy
msgctxt "tfrmfileproperties.sgimage.columns[0].title.caption"
msgid "Name"
msgstr "Name"

#: tfrmfileproperties.sgimage.columns[1].title.caption
msgctxt "tfrmfileproperties.sgimage.columns[1].title.caption"
msgid "Value"
msgstr "Wert"

#: tfrmfileproperties.tsattributes.caption
msgctxt "TFRMFILEPROPERTIES.TSATTRIBUTES.CAPTION"
msgid "Attributes"
msgstr "Attribute"

#: tfrmfileproperties.tsplugins.caption
#, fuzzy
msgctxt "tfrmfileproperties.tsplugins.caption"
msgid "Plugins"
msgstr "Plugins"

#: tfrmfileproperties.tsproperties.caption
msgctxt "TFRMFILEPROPERTIES.TSPROPERTIES.CAPTION"
msgid "Properties"
msgstr "Eigenschaften"

#: tfrmfinddlg.actcancel.caption
msgctxt "tfrmfinddlg.actcancel.caption"
msgid "C&ancel"
msgstr "&Abbrechen"

#: tfrmfinddlg.actcancelclose.caption
msgid "Cancel search and close window"
msgstr "S&chließen"

#: tfrmfinddlg.actclose.caption
msgctxt "tfrmfinddlg.actclose.caption"
msgid "&Close"
msgstr "Schließen"

#: tfrmfinddlg.actconfigfilesearchhotkeys.caption
msgctxt "tfrmfinddlg.actconfigfilesearchhotkeys.caption"
msgid "Configuration of hot keys"
msgstr ""

#: tfrmfinddlg.actedit.caption
msgctxt "tfrmfinddlg.actedit.caption"
msgid "&Edit"
msgstr "Bea&rbeiten"

#: tfrmfinddlg.actfeedtolistbox.caption
msgid "Feed to &listbox"
msgstr "Füge in &Listbox ein"

#: tfrmfinddlg.actfreefrommem.caption
msgid "Cancel search, close and free from memory"
msgstr ""

#: tfrmfinddlg.actfreefrommemallothers.caption
msgid "For all other \"Find files\", cancel, close and free from memory"
msgstr ""

#: tfrmfinddlg.actgotofile.caption
msgid "&Go to file"
msgstr "&Gehe zu Datei"

#: tfrmfinddlg.actintellifocus.caption
msgctxt "tfrmfinddlg.actintellifocus.caption"
msgid "Find Data"
msgstr "Finde Daten"

#: tfrmfinddlg.actlastsearch.caption
msgid "&Last search"
msgstr "&Letzte Suche"

#: tfrmfinddlg.actnewsearch.caption
msgid "&New search"
msgstr "&Neue Suche"

#: tfrmfinddlg.actnewsearchclearfilters.caption
msgid "New search (clear filters)"
msgstr ""

#: tfrmfinddlg.actpageadvanced.caption
msgid "Go to page \"Advanced\""
msgstr "Gehe zu Seite \"Fortgeschritten\""

#: tfrmfinddlg.actpageloadsave.caption
msgid "Go to page \"Load/Save\""
msgstr "Gehe zu Seite \"Laden/Speichern\""

#: tfrmfinddlg.actpagenext.caption
msgid "Switch to Nex&t Page"
msgstr ""

#: tfrmfinddlg.actpageplugins.caption
msgid "Go to page \"Plugins\""
msgstr "Gehe zu Seite \"Plugins\""

#: tfrmfinddlg.actpageprev.caption
msgid "Switch to &Previous Page"
msgstr ""

#: tfrmfinddlg.actpageresults.caption
msgid "Go to page \"Results\""
msgstr "Gehe zu Seite \"Ergebnisse\""

#: tfrmfinddlg.actpagestandard.caption
msgid "Go to page \"Standard\""
msgstr "Gehe zu Seite \"Standard\""

#: tfrmfinddlg.actstart.caption
msgctxt "tfrmfinddlg.actstart.caption"
msgid "&Start"
msgstr "&Starten"

#: tfrmfinddlg.actview.caption
msgctxt "tfrmfinddlg.actview.caption"
msgid "&View"
msgstr "&Betrachten"

#: tfrmfinddlg.btnaddattribute.caption
msgctxt "tfrmfinddlg.btnaddattribute.caption"
msgid "&Add"
msgstr "&Hinzufügen"

#: tfrmfinddlg.btnattrshelp.caption
msgctxt "TFRMFINDDLG.BTNATTRSHELP.CAPTION"
msgid "&Help"
msgstr "&Hilfe"

#: tfrmfinddlg.btnsavetemplate.caption
msgctxt "tfrmfinddlg.btnsavetemplate.caption"
msgid "&Save"
msgstr "&Speichern"

#: tfrmfinddlg.btnsearchdelete.caption
msgctxt "TFRMFINDDLG.BTNSEARCHDELETE.CAPTION"
msgid "&Delete"
msgstr "L&öschen"

#: tfrmfinddlg.btnsearchload.caption
msgid "L&oad"
msgstr "&Laden"

#: tfrmfinddlg.btnsearchsave.caption
msgid "S&ave"
msgstr "&Speichern"

#: tfrmfinddlg.btnsearchsavewithstartingpath.caption
msgid "Sa&ve with \"Start in directory\""
msgstr "S&peichern mit Start-Pfad"

#: tfrmfinddlg.btnsearchsavewithstartingpath.hint
msgid "If saved then \"Start in directory\" will be restored when loading template. Use it if you want to fix searching to a certain directory"
msgstr "Wenn der Start-Pfad mitgepeichert wird, wird er wiederhergestellt, wenn die Vorlage geladen wird. Nützlich, wenn eine Suche immer im gleichen Verzeichnis gestartet werden soll."

#: tfrmfinddlg.btnusetemplate.caption
msgid "Use template"
msgstr "Vorlage benutzen"

#: tfrmfinddlg.caption
msgctxt "tfrmfinddlg.caption"
msgid "Find files"
msgstr "Dateien suchen"

#: tfrmfinddlg.cbcasesens.caption
msgid "Case sens&itive"
msgstr "Groß-/Kle&inschreibung beachten"

#: tfrmfinddlg.cbdatefrom.caption
msgid "&Date from:"
msgstr "Ab &Datum:"

#: tfrmfinddlg.cbdateto.caption
msgid "Dat&e to:"
msgstr "&Vor Datum:"

#: tfrmfinddlg.cbfilesizefrom.caption
msgid "S&ize from:"
msgstr "Date&igröße ab:"

#: tfrmfinddlg.cbfilesizeto.caption
msgid "Si&ze to:"
msgstr "Bis Dateigr&öße"

#: tfrmfinddlg.cbfindinarchive.caption
msgid "Search in &archives"
msgstr "In &Archiv(en) suchen"

#: tfrmfinddlg.cbfindtext.caption
msgctxt "TFRMFINDDLG.CBFINDTEXT.CAPTION"
msgid "Find &text in file"
msgstr "&Text suchen"

#: tfrmfinddlg.cbfollowsymlinks.caption
msgid "Follow s&ymlinks"
msgstr "S&ymlinks folgen"

#: tfrmfinddlg.cbnotcontainingtext.caption
msgctxt "TFRMFINDDLG.CBNOTCONTAININGTEXT.CAPTION"
msgid "Find files N&OT containing the text"
msgstr "Suche Datei die &NICHT den Text enthalten"

#: tfrmfinddlg.cbnotolderthan.caption
msgid "N&ot older than:"
msgstr "Nicht &älter als:"

#: tfrmfinddlg.cbopenedtabs.caption
msgid "Opened tabs"
msgstr "Geöffnete Tabs"

#: tfrmfinddlg.cbpartialnamesearch.caption
msgid "Searc&h for part of file name"
msgstr "Suc&he nach Teil des Dateinamens"

#: tfrmfinddlg.cbregexp.caption
msgctxt "TFRMFINDDLG.CBREGEXP.CAPTION"
msgid "&Regular expression"
msgstr "&Reguläre Ausdrücke"

#: tfrmfinddlg.cbreplacetext.caption
msgid "Re&place by"
msgstr "E&rsetze mit"

#: tfrmfinddlg.cbselectedfiles.caption
msgid "Selected directories and &files"
msgstr "Ausgew&ählte Verzeichnisse und Dateien"

#: tfrmfinddlg.cbtextregexp.caption
msgid "Regular &expression"
msgstr "R&egulärer Ausdruck"

#: tfrmfinddlg.cbtimefrom.caption
msgid "&Time from:"
msgstr "Zeit &von:"

#: tfrmfinddlg.cbtimeto.caption
msgid "Ti&me to:"
msgstr "Zeit &bis:"

#: tfrmfinddlg.cbuseplugin.caption
msgid "&Use search plugin:"
msgstr "Nutze Such-PlugIn"

#: tfrmfinddlg.cmbexcludedirectories.hint
msgid "Enter directories names that should be excluded from search separated with \";\""
msgstr "Verzeichnisnamen eingeben, die von der Suche ausgeschlossen werden sollen (Namen mit \";\" trennen)"

#: tfrmfinddlg.cmbexcludefiles.hint
msgid "Enter files names that should be excluded from search separated with \";\""
msgstr "Dateinamen eingeben, die von der Suche ausgeschlossen werden sollen (Namen mit \";\" trennen)"

#: tfrmfinddlg.cmbfindfilemask.hint
msgid "Enter files names separated with \";\""
msgstr "Dateinamen durch \";\" getrennt eingeben"

#: tfrmfinddlg.gbdirectories.caption
msgctxt "tfrmfinddlg.gbdirectories.caption"
msgid "Directories"
msgstr "Verzeichnisse"

#: tfrmfinddlg.gbfiles.caption
msgctxt "tfrmfinddlg.gbfiles.caption"
msgid "Files"
msgstr "Dateien"

#: tfrmfinddlg.gbfinddata.caption
msgctxt "tfrmfinddlg.gbfinddata.caption"
msgid "Find Data"
msgstr "In Dateien suchen"

#: tfrmfinddlg.lblattributes.caption
msgid "Attri&butes"
msgstr "Attri&bute"

#: tfrmfinddlg.lblencoding.caption
msgid "Encodin&g:"
msgstr "&Kodierung:"

#: tfrmfinddlg.lblexcludedirectories.caption
msgid "E&xclude subdirectories"
msgstr "Unterverzeichnisse &ausschließen"

#: tfrmfinddlg.lblexcludefiles.caption
msgid "&Exclude files"
msgstr "Dateien a&usschließen"

#: tfrmfinddlg.lblfindfilemask.caption
msgid "&File mask"
msgstr "&Dateimaske"

#: tfrmfinddlg.lblfindpathstart.caption
msgid "Start in &directory"
msgstr "&In Verzeichnis starten"

#: tfrmfinddlg.lblsearchdepth.caption
msgid "Search su&bdirectories:"
msgstr "Unter&verzeichnisse durchsuchen:"

#: tfrmfinddlg.lbltemplateheader.caption
msgid "&Previous searches:"
msgstr "&Vorherige Suche(n)"

#: tfrmfinddlg.miaction.caption
msgid "&Action"
msgstr ""

#: tfrmfinddlg.mifreefrommemallothers.caption
msgid "For all others, cancel, close and free from memory"
msgstr ""

#: tfrmfinddlg.miopeninnewtab.caption
msgid "Open In New Tab(s)"
msgstr "In (einem) neuen Tab(s) öffnen"

#: tfrmfinddlg.mioptions.caption
msgctxt "tfrmfinddlg.mioptions.caption"
msgid "Options"
msgstr "Optionen"

#: tfrmfinddlg.miremovefromllist.caption
msgid "Remove from list"
msgstr "Von der Liste entfernen"

#: tfrmfinddlg.miresult.caption
msgid "&Result"
msgstr "&Ergebnisse"

#: tfrmfinddlg.miseparator1.caption
#, fuzzy
msgctxt "tfrmfinddlg.miseparator1.caption"
msgid "-"
msgstr "-"

#: tfrmfinddlg.miseparator2.caption
#, fuzzy
msgctxt "tfrmfinddlg.miseparator2.caption"
msgid "-"
msgstr "-"

#: tfrmfinddlg.mishowallfound.caption
msgid "Show all found items"
msgstr "Alle gefundenen Einträge anzeigen"

#: tfrmfinddlg.mishowineditor.caption
msgid "Show In Editor"
msgstr "In Editor öffnen"

#: tfrmfinddlg.mishowinviewer.caption
msgid "Show In Viewer"
msgstr "Zeige in Betrachter"

#: tfrmfinddlg.miviewtab.caption
#, fuzzy
msgctxt "tfrmfinddlg.miviewtab.caption"
msgid "&View"
msgstr "&Anzeigen"

#: tfrmfinddlg.tsadvanced.caption
msgid "Advanced"
msgstr "Erweitert"

#: tfrmfinddlg.tsloadsave.caption
msgid "Load/Save"
msgstr "Laden/Speichern"

#: tfrmfinddlg.tsplugins.caption
msgctxt "tfrmfinddlg.tsplugins.caption"
msgid "Plugins"
msgstr "Plugins"

#: tfrmfinddlg.tsresults.caption
msgid "Results"
msgstr "Ergebnisse"

#: tfrmfinddlg.tsstandard.caption
msgid "Standard"
msgstr "Standard"

#: tfrmfindview.btnclose.caption
msgctxt "TFRMFINDVIEW.BTNCLOSE.CAPTION"
msgid "&Cancel"
msgstr "&Abbrechen"

#: tfrmfindview.btnfind.caption
msgctxt "TFRMFINDVIEW.BTNFIND.CAPTION"
msgid "&Find"
msgstr "&Suchen"

#: tfrmfindview.caption
msgctxt "TFRMFINDVIEW.CAPTION"
msgid "Find"
msgstr "Suchen"

#: tfrmfindview.cbcasesens.caption
msgid "C&ase sensitive"
msgstr "Schreibweise be&achten"

#: tfrmhardlink.btncancel.caption
msgctxt "TFRMHARDLINK.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Abbrechen"

#: tfrmhardlink.btnok.caption
msgctxt "TFRMHARDLINK.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"

#: tfrmhardlink.caption
msgid "Create hard link"
msgstr "Erstelle Hardlink"

#: tfrmhardlink.lblexistingfile.caption
msgctxt "tfrmhardlink.lblexistingfile.caption"
msgid "&Destination that the link will point to"
msgstr "Bestehen&des Ziel (auf das der Hardlink zeigt)"

#: tfrmhardlink.lbllinktocreate.caption
msgctxt "TFRMHARDLINK.LBLLINKTOCREATE.CAPTION"
msgid "&Link name"
msgstr "Hard&link-Name"

#: tfrmhotdirexportimport.btnselectall.caption
msgctxt "tfrmhotdirexportimport.btnselectall.caption"
msgid "Import all!"
msgstr "Alle importieren!"

#: tfrmhotdirexportimport.btnselectiondone.caption
msgctxt "tfrmhotdirexportimport.btnselectiondone.caption"
msgid "Import selected"
msgstr "Ausgewählte importieren"

#: tfrmhotdirexportimport.caption
msgctxt "tfrmhotdirexportimport.caption"
msgid "Select the entries your want to import"
msgstr "Einträge auswählen, die importiert werden sollen"

#: tfrmhotdirexportimport.lbhint.caption
msgctxt "tfrmhotdirexportimport.lbhint.caption"
msgid "When clicking a sub-menu, it will select the whole menu"
msgstr "Wird ein Untermenü ausgewählt, wird das ganze Menü ausgewählt"

#: tfrmhotdirexportimport.lblhintholdcontrol.caption
msgid "Hold CTRL and click entries to select multiple ones"
msgstr "Strg halten und Einträge anklicken um mehrere auszuwählen"

#: tfrmlinker.btnsave.caption
msgctxt "TFRMLINKER.BTNSAVE.CAPTION"
msgid "..."
msgstr "..."

#: tfrmlinker.caption
msgctxt "TFRMLINKER.CAPTION"
msgid "Linker"
msgstr "Verschmelzer"

#: tfrmlinker.gbsaveto.caption
msgid "Save to..."
msgstr "Speichern unter..."

#: tfrmlinker.grbxcontrol.caption
msgid "Item"
msgstr "Eintrag"

#: tfrmlinker.lblfilename.caption
msgctxt "TFRMLINKER.LBLFILENAME.CAPTION"
msgid "&File name"
msgstr "&Dateiname"

#: tfrmlinker.spbtndown.caption
msgctxt "TFRMLINKER.SPBTNDOWN.CAPTION"
msgid "Do&wn"
msgstr "A&bwärts"

#: tfrmlinker.spbtndown.hint
msgctxt "TFRMLINKER.SPBTNDOWN.HINT"
msgid "Down"
msgstr "A&bwärts"

#: tfrmlinker.spbtnrem.caption
msgctxt "tfrmlinker.spbtnrem.caption"
msgid "&Remove"
msgstr "Entfe&rnen"

#: tfrmlinker.spbtnrem.hint
msgctxt "tfrmlinker.spbtnrem.hint"
msgid "Delete"
msgstr "&Löschen"

#: tfrmlinker.spbtnup.caption
msgctxt "TFRMLINKER.SPBTNUP.CAPTION"
msgid "&Up"
msgstr "Aufw&ärts"

#: tfrmlinker.spbtnup.hint
msgctxt "TFRMLINKER.SPBTNUP.HINT"
msgid "Up"
msgstr "Aufw&ärts"

#: tfrmmain.actabout.caption
msgid "&About"
msgstr "&Über..."

#: tfrmmain.actaddfilenametocmdline.caption
msgid "Add file name to command line"
msgstr "Dateiname in die Befehlszeile kopieren"

#: tfrmmain.actaddnewsearch.caption
msgid "New search instance..."
msgstr "Neues Such-Fenster..."

#: tfrmmain.actaddpathandfilenametocmdline.caption
msgid "Add path and file name to command line"
msgstr "Pfad und Dateiname in die Befehlszeile kopieren"

#: tfrmmain.actaddpathtocmdline.caption
msgid "Copy path to command line"
msgstr "&Pfad in die Befehlszeile eintragen"

#: tfrmmain.actbriefview.caption
msgctxt "tfrmmain.actbriefview.caption"
msgid "Brief view"
msgstr "Verkürzt"

#: tfrmmain.actbriefview.hint
msgid "Brief View"
msgstr "Verkürzte Ansicht"

#: tfrmmain.actcalculatespace.caption
msgid "Calculate &Occupied Space"
msgstr "Berechne belegten &Speicherplatz..."

#: tfrmmain.actchangedir.caption
msgid "Change directory"
msgstr "Verzeichnis wechseln"

#: tfrmmain.actchangedirtohome.caption
msgid "Change directory to home"
msgstr "Wechsel zum Home-Verzeichnis (Nutzer)"

#: tfrmmain.actchangedirtoparent.caption
msgid "Change Directory To Parent"
msgstr "In das übergeordnete Verzeichnis wechseln"

#: tfrmmain.actchangedirtoroot.caption
msgid "Change directory to root"
msgstr "Verzeichnis zu Root wechseln"

#: tfrmmain.actchecksumcalc.caption
msgctxt "TFRMMAIN.ACTCHECKSUMCALC.CAPTION"
msgid "Calculate Check&sum..."
msgstr "Berechne Prüf&summe..."

#: tfrmmain.actchecksumverify.caption
msgctxt "TFRMMAIN.ACTCHECKSUMVERIFY.CAPTION"
msgid "&Verify Checksum..."
msgstr "&Verifiziere Prüfsumme..."

#: tfrmmain.actclearlogfile.caption
msgid "Clear log file"
msgstr "Log-Datei leeren"

#: tfrmmain.actclearlogwindow.caption
msgid "Clear log window"
msgstr "Log-Fenster leeren"

#: tfrmmain.actclosealltabs.caption
msgctxt "tfrmmain.actclosealltabs.caption"
msgid "Close &All Tabs"
msgstr "&Alle Tabs schließen"

#: tfrmmain.actcloseduplicatetabs.caption
msgid "Close Duplicate Tabs"
msgstr "Doppelte Tabs schließen"

#: tfrmmain.actclosetab.caption
msgid "&Close Tab"
msgstr "Tab &schließen"

#: tfrmmain.actcmdlinenext.caption
msgid "Next Command Line"
msgstr "Nächste Befehlszeile"

#: tfrmmain.actcmdlinenext.hint
msgid "Set command line to next command in history"
msgstr "Stelle Befehlszeile auf den nächsten Befehl im Verlauf"

#: tfrmmain.actcmdlineprev.caption
msgid "Previous Command Line"
msgstr "Vorher eingegebener Befehl"

#: tfrmmain.actcmdlineprev.hint
msgid "Set command line to previous command in history"
msgstr "Nutze die Befehlszeile mit dem zuletzt eingegebenen Befehl"

#: tfrmmain.actcolumnsview.caption
msgid "Full"
msgstr "Vollständig"

#: tfrmmain.actcolumnsview.hint
msgid "Columns View"
msgstr "Spaltenansicht"

#: tfrmmain.actcomparecontents.caption
msgid "Compare by &Contents"
msgstr "Anhand des &Inhalts vergleichen"

#: tfrmmain.actcomparedirectories.caption
msgctxt "TFRMMAIN.ACTCOMPAREDIRECTORIES.CAPTION"
msgid "Compare Directories"
msgstr "Vergleiche Ordner/Verzeichnisse"

#: tfrmmain.actcomparedirectories.hint
msgctxt "TFRMMAIN.ACTCOMPAREDIRECTORIES.HINT"
msgid "Compare Directories"
msgstr "Vergleiche Ordner/Verzeichnisse"

#: tfrmmain.actconfigdirhotlist.caption
msgctxt "tfrmmain.actconfigdirhotlist.caption"
msgid "Configuration of Directory Hotlist"
msgstr "Konfiguration der Verzeichnis-Hotlist"

#: tfrmmain.actconfigfavoritetabs.caption
msgid "Configuration of Favorite Tabs"
msgstr "Konfiguration der Favoriten-Tabs"

#: tfrmmain.actconfigfoldertabs.caption
msgid "Configuration of folder tabs"
msgstr "Konfiguration der Verzeichnis-Tabs"

#: tfrmmain.actconfighotkeys.caption
msgctxt "tfrmmain.actconfighotkeys.caption"
msgid "Configuration of hot keys"
msgstr "Konfiguration der Hot-Keys"

#: tfrmmain.actconfigsavesettings.caption
msgid "Save Settings"
msgstr "Einstellungen speichern"

#: tfrmmain.actconfigsearches.caption
msgid "Configuration of searches"
msgstr ""

#: tfrmmain.actconfigtoolbars.caption
msgid "Toolbar..."
msgstr "Toolbar..."

#: tfrmmain.actconfigtreeviewmenus.caption
msgctxt "tfrmmain.actconfigtreeviewmenus.caption"
msgid "Configuration of Tree View Menu"
msgstr "Konfiguration Baumansicht Menü"

#: tfrmmain.actconfigtreeviewmenuscolors.caption
msgctxt "tfrmmain.actconfigtreeviewmenuscolors.caption"
msgid "Configuration of Tree View Menu Colors"
msgstr "Konfiguration Baumansicht Menü Farben"

#: tfrmmain.actcontextmenu.caption
msgid "Show context menu"
msgstr "&Zeige Kontextmenü"

#: tfrmmain.actcopy.caption
msgctxt "tfrmmain.actcopy.caption"
msgid "Copy"
msgstr "Kopieren"

#: tfrmmain.actcopyalltabstoopposite.caption
msgid "Copy all tabs to opposite side"
msgstr "Alle Tabs auf die gegenüberliegende Seite kopieren"

#: tfrmmain.actcopyfiledetailstoclip.caption
msgid "Copy all shown &columns"
msgstr "Kopiere alle ange&zeigten Spalten"

#: tfrmmain.actcopyfullnamestoclip.caption
msgid "Copy Filename(s) with Full &Path"
msgstr "Kopiere Dateinamen mit komplettem &Pfad"

#: tfrmmain.actcopynamestoclip.caption
msgid "Copy &Filename(s) to Clipboard"
msgstr "Kopiere Datei&namen in die Zwischenablage"

#: tfrmmain.actcopynoask.caption
msgid "Copy files without asking for confirmation"
msgstr "Datei(en) ohne Nachfrage kopieren"

#: tfrmmain.actcopypathnosepoffilestoclip.caption
msgid "Copy Full Path of selected file(s) with no ending dir separator"
msgstr "Kopiere den kompletten Pfad der markierten Datei(en) ohne Verzeichnis-Trennzeichen am Ende (/)"

#: tfrmmain.actcopypathoffilestoclip.caption
msgid "Copy Full Path of selected file(s)"
msgstr "Kopiere den kompletten Pfad der markierten Datei(en)"

#: tfrmmain.actcopysamepanel.caption
msgid "Copy to same panel"
msgstr "Kopiere in gleichen Ordner"

#: tfrmmain.actcopytoclipboard.caption
msgid "&Copy"
msgstr "&Kopieren"

#: tfrmmain.actcountdircontent.caption
msgid "Sho&w Occupied Space"
msgstr "&Belegten Speicherplatz anzeigen"

#: tfrmmain.actcuttoclipboard.caption
msgid "Cu&t"
msgstr "A&usschneiden"

#: tfrmmain.actdebugshowcommandparameters.caption
msgid "Show Command Parameters"
msgstr "Zeige Befehlsparameter"

#: tfrmmain.actdelete.caption
msgctxt "TFRMMAIN.ACTDELETE.CAPTION"
msgid "Delete"
msgstr "Löschen"

#: tfrmmain.actdeletesearches.caption
msgid "For all searches, cancel, close and free memory"
msgstr ""

#: tfrmmain.actdirhistory.caption
msgctxt "TFRMMAIN.ACTDIRHISTORY.CAPTION"
msgid "Directory history"
msgstr "Verzeichnisverlauf"

#: tfrmmain.actdirhotlist.caption
msgid "Directory &Hotlist"
msgstr "Verzeic&hnis-Favoriten"

#: tfrmmain.actdoanycmcommand.caption
msgid "Select any command and execute it"
msgstr "Einen Befehl wählen und ausführen"

#: tfrmmain.actedit.caption
msgctxt "tfrmmain.actedit.caption"
msgid "Edit"
msgstr "Bearbeiten"

#: tfrmmain.acteditcomment.caption
msgid "Edit Co&mment..."
msgstr "Ko&mmentar bearbeiten..."

#: tfrmmain.acteditnew.caption
msgid "Edit new file"
msgstr "Datei erstellen und bearbeiten"

#: tfrmmain.acteditpath.caption
msgid "Edit path field above file list"
msgstr "Pfad-Zeile über der Dateiliste bearbeiten"

#: tfrmmain.actexchange.caption
msgid "Swap &Panels"
msgstr "&Panels tauschen"

#: tfrmmain.actexecutescript.caption
msgid "Execute Script"
msgstr "Script ausführen"

#: tfrmmain.actexit.caption
msgctxt "TFRMMAIN.ACTEXIT.CAPTION"
msgid "E&xit"
msgstr "&Beenden"

#: tfrmmain.actextractfiles.caption
msgid "&Extract Files..."
msgstr "E&ntpacke Dateien..."

#: tfrmmain.actfileassoc.caption
msgid "Configuration of File &Associations"
msgstr "Konfiguration der Dateiverkn&üpfungen"

#: tfrmmain.actfilelinker.caption
msgid "Com&bine Files..."
msgstr "&Verbinde Dateien..."

#: tfrmmain.actfileproperties.caption
msgid "Show &File Properties"
msgstr "Dateiei&genschaften anzeigen..."

#: tfrmmain.actfilespliter.caption
msgid "Spl&it File..."
msgstr "&Teile Datei..."

#: tfrmmain.actflatview.caption
msgid "&Flat view"
msgstr "\"&Flache\" Ansicht"

#: tfrmmain.actfocuscmdline.caption
msgid "Focus command line"
msgstr "Fokus auf die Befehlsze&ile"

#: tfrmmain.actfocusswap.caption
msgid "Swap focus"
msgstr ""

#: tfrmmain.actfocusswap.hint
msgid "Switch between left and right file list"
msgstr ""

#: tfrmmain.actgotofirstfile.caption
msgid "Place cursor on first file in list"
msgstr "Setze die Einfügemarke auf den ersten Eintrag der Liste"

#: tfrmmain.actgotolastfile.caption
msgid "Place cursor on last file in list"
msgstr "Setze die Einfügemarke auf den letzten Eintrag der Liste"

#: tfrmmain.acthardlink.caption
msgid "Create &Hard Link..."
msgstr "Erstelle &Hardlink..."

#: tfrmmain.acthelpindex.caption
msgid "&Contents"
msgstr "Hilfe &Index"

#: tfrmmain.acthorizontalfilepanels.caption
msgid "&Horizontal Panels Mode"
msgstr "&Horizontale Datei-Panel"

#: tfrmmain.actkeyboard.caption
msgid "&Keyboard"
msgstr "&Tastaturkürzel Index"

#: tfrmmain.actleftbriefview.caption
msgid "Brief view on left panel"
msgstr "Verkürzte Ansicht im linken Panel"

#: tfrmmain.actleftcolumnsview.caption
msgid "Columns view on left panel"
msgstr "Spaltenansicht im linken Panel"

#: tfrmmain.actleftequalright.caption
msgid "Left &= Right"
msgstr "Links &= Rechts"

#: tfrmmain.actleftflatview.caption
msgid "&Flat view on left panel"
msgstr "&Flache Ansicht im linken Panel"

#: tfrmmain.actleftopendrives.caption
msgid "Open left drive list"
msgstr "Öffne &linke Laufwerksliste"

#: tfrmmain.actleftreverseorder.caption
msgid "Re&verse order on left panel"
msgstr "Umgekehrte Reihenfolge im linken Panel"

#: tfrmmain.actleftsortbyattr.caption
msgid "Sort left panel by &Attributes"
msgstr "Linkes Panel nach &Attributen sortieren"

#: tfrmmain.actleftsortbydate.caption
msgid "Sort left panel by &Date"
msgstr "Linkes Panel nach &Datum sortieren"

#: tfrmmain.actleftsortbyext.caption
msgid "Sort left panel by &Extension"
msgstr "Linkes Panel nach &Dateiendung sortieren"

#: tfrmmain.actleftsortbyname.caption
msgid "Sort left panel by &Name"
msgstr "Linkes Panel nach &Namen sortieren"

#: tfrmmain.actleftsortbysize.caption
msgid "Sort left panel by &Size"
msgstr "Linkes Panel nach &Größe sortieren"

#: tfrmmain.actleftthumbview.caption
msgid "Thumbnails view on left panel"
msgstr "Thumbnails-Ansicht im linken Panel"

#: tfrmmain.actloadfavoritetabs.caption
msgid "Load tabs from Favorite Tabs"
msgstr "Tabs aus den Favoriten-Tabs laden"

#: tfrmmain.actloadselectionfromclip.caption
msgid "Load Selection from Clip&board"
msgstr "Auswahl aus der &Zwischenablage laden"

#: tfrmmain.actloadselectionfromfile.caption
msgid "&Load Selection from File..."
msgstr "Auswah&l aus Datei laden..."

#: tfrmmain.actloadtabs.caption
msgid "&Load Tabs from File"
msgstr "&Lade Tabs aus Datei"

#: tfrmmain.actmakedir.caption
msgid "Create &Directory"
msgstr "&Verzeichnis erstellen..."

#: tfrmmain.actmarkcurrentextension.caption
msgid "Select All with the Same E&xtension"
msgstr "Alle mit gleicher &Endung markieren"

#: tfrmmain.actmarkcurrentname.caption
msgid "Select all files with same name"
msgstr ""

#: tfrmmain.actmarkcurrentnameext.caption
msgid "Select all files with same name and extension"
msgstr ""

#: tfrmmain.actmarkcurrentpath.caption
msgid "Select all in same path"
msgstr ""

#: tfrmmain.actmarkinvert.caption
msgid "&Invert Selection"
msgstr "Auswahl um&kehren"

#: tfrmmain.actmarkmarkall.caption
msgid "&Select All"
msgstr "Alle&s markieren"

#: tfrmmain.actmarkminus.caption
msgid "Unselect a Gro&up..."
msgstr "Gru&ppe abwählen..."

#: tfrmmain.actmarkplus.caption
msgid "Select a &Group..."
msgstr "&Gruppe markieren..."

#: tfrmmain.actmarkunmarkall.caption
msgid "&Unselect All"
msgstr "Alles a&bwählen"

#: tfrmmain.actminimize.caption
msgid "Minimize window"
msgstr "Fenster minimieren"

#: tfrmmain.actmultirename.caption
msgid "Multi &Rename Tool"
msgstr "Meh&rfaches Umbenennen..."

#: tfrmmain.actnetworkconnect.caption
msgid "Network &Connect..."
msgstr "Net&zwerk verbinden..."

#: tfrmmain.actnetworkdisconnect.caption
msgid "Network &Disconnect"
msgstr "Netzwerk &trennen"

#: tfrmmain.actnetworkquickconnect.caption
msgid "Network &Quick Connect..."
msgstr "Netzwerk schnell &verbinden..."

#: tfrmmain.actnewtab.caption
msgid "&New Tab"
msgstr "Ne&uer Tab"

#: tfrmmain.actnextfavoritetabs.caption
msgid "Load the Next Favorite Tabs in the list"
msgstr "Nächsten Tab aus der Liste laden"

#: tfrmmain.actnexttab.caption
msgid "Switch to Nex&t Tab"
msgstr "Zum n&ächsten Tab wechseln"

#: tfrmmain.actopen.caption
msgctxt "TFRMMAIN.ACTOPEN.CAPTION"
msgid "Open"
msgstr "Öffnen"

#: tfrmmain.actopenarchive.caption
msgid "Try open archive"
msgstr "Versuche Archiv zu öffnen"

#: tfrmmain.actopenbar.caption
msgid "Open bar file"
msgstr "Leisten-Datei öffnen"

#: tfrmmain.actopendirinnewtab.caption
msgid "Open &Folder in a New Tab"
msgstr "Verzeichnis in neue&m Tab öffnen"

#: tfrmmain.actopenvirtualfilesystemlist.caption
msgid "Open &VFS List"
msgstr "Öffne &VFS-Liste"

#: tfrmmain.actoperationsviewer.caption
msgid "Operations &Viewer"
msgstr "Ablauf-&Betrachter"

#: tfrmmain.actoptions.caption
msgid "&Options..."
msgstr "&Optionen..."

#: tfrmmain.actpackfiles.caption
msgid "&Pack Files..."
msgstr "&Packe Dateien..."

#: tfrmmain.actpanelssplitterperpos.caption
msgid "Set splitter position"
msgstr "Position des Fenster-Teilers festlegen"

#: tfrmmain.actpastefromclipboard.caption
msgid "&Paste"
msgstr "Einf&ügen"

#: tfrmmain.actpreviousfavoritetabs.caption
msgid "Load the Previous Favorite Tabs in the list"
msgstr "Vorherigen Tab aus der Liste laden"

#: tfrmmain.actprevtab.caption
msgid "Switch to &Previous Tab"
msgstr "Zum v&orherigen Tab wechseln"

#: tfrmmain.actquickfilter.caption
msgid "Quick filter"
msgstr "Schneller Filter"

#: tfrmmain.actquicksearch.caption
msgctxt "TFRMMAIN.ACTQUICKSEARCH.CAPTION"
msgid "Quick search"
msgstr "Schnelle Suche"

#: tfrmmain.actquickview.caption
msgid "&Quick View Panel"
msgstr "S&chnellansicht"

#: tfrmmain.actrefresh.caption
msgid "&Refresh"
msgstr "A&ktualisieren"

#: tfrmmain.actreloadfavoritetabs.caption
msgid "Reload the last Favorite Tabs loaded"
msgstr "Zuletzt geladenen Tab erneut öffnen"

#: tfrmmain.actrename.caption
msgctxt "tfrmmain.actrename.caption"
msgid "Move"
msgstr "Verschieben"

#: tfrmmain.actrenamenoask.caption
msgid "Move/Rename files without asking for confirmation"
msgstr "Verschieben / Umbenennen von Datei(en) ohne Nachfrage"

#: tfrmmain.actrenameonly.caption
msgctxt "TFRMMAIN.ACTRENAMEONLY.CAPTION"
msgid "Rename"
msgstr "Umbenennen"

#: tfrmmain.actrenametab.caption
msgid "&Rename Tab"
msgstr "&Tab umbenennen"

#: tfrmmain.actresavefavoritetabs.caption
msgid "Resave on the last Favorite Tabs loaded"
msgstr "Neu im letzten geladenen Favoriten-Tab speichern"

#: tfrmmain.actrestoreselection.caption
msgid "&Restore Selection"
msgstr "Auswahl w&iederherstellen"

#: tfrmmain.actreverseorder.caption
msgid "Re&verse Order"
msgstr "&Umgekehrt anordnen"

#: tfrmmain.actrightbriefview.caption
msgid "Brief view on right panel"
msgstr "Verkürzte Ansicht im rechten Panel"

#: tfrmmain.actrightcolumnsview.caption
msgid "Columns view on right panel"
msgstr "Spaltenansicht im rechten Panel"

#: tfrmmain.actrightequalleft.caption
msgid "Right &= Left"
msgstr "Rechts = L&inks"

#: tfrmmain.actrightflatview.caption
msgid "&Flat view on right panel"
msgstr "&Flache Ansicht im rechten Panel"

#: tfrmmain.actrightopendrives.caption
msgid "Open right drive list"
msgstr "Öffne rechte Laufwerksliste"

#: tfrmmain.actrightreverseorder.caption
msgid "Re&verse order on right panel"
msgstr "Umgekehrte Anordnung im rechten Panel"

#: tfrmmain.actrightsortbyattr.caption
msgid "Sort right panel by &Attributes"
msgstr "Rechtes Panel nach &Attributen sortieren"

#: tfrmmain.actrightsortbydate.caption
msgid "Sort right panel by &Date"
msgstr "Rechtes Panel nach &Datum sortieren"

#: tfrmmain.actrightsortbyext.caption
msgid "Sort right panel by &Extension"
msgstr "Rechtes Panel nach &Dateiendung sortieren"

#: tfrmmain.actrightsortbyname.caption
msgid "Sort right panel by &Name"
msgstr "Rechtes Panel nach &Namen sortieren"

#: tfrmmain.actrightsortbysize.caption
msgid "Sort right panel by &Size"
msgstr "Rechtes Panel nach &Größe sortieren "

#: tfrmmain.actrightthumbview.caption
msgid "Thumbnails view on right panel"
msgstr "Thumbnail-Ansicht im rechten Panel"

#: tfrmmain.actrunterm.caption
msgid "Run &Terminal"
msgstr "Kommandozeilen-Fens&ter öffnen"

#: tfrmmain.actsavefavoritetabs.caption
msgid "Save current tabs to a New Favorite Tabs"
msgstr "Aktuellen Tab in neuen Favoriten-Tab speichern"

#: tfrmmain.actsaveselection.caption
msgid "Sa&ve Selection"
msgstr "Auswahl speiche&rn"

#: tfrmmain.actsaveselectiontofile.caption
msgid "Save S&election to File..."
msgstr "Auswa&hl in Datei speichern..."

#: tfrmmain.actsavetabs.caption
msgid "&Save Tabs to File"
msgstr "&Speichere Tabs in Datei"

#: tfrmmain.actsearch.caption
msgid "&Search..."
msgstr "&Suchen..."

#: tfrmmain.actsetalltabsoptiondirsinnewtab.caption
msgid "All tabs Locked with Dir Opened in New Tabs"
msgstr "Alle gesperrten Tabs, in denen Verzeichnisse in neuen Tabs geöffnet werden"

#: tfrmmain.actsetalltabsoptionnormal.caption
msgid "Set all tabs to Normal"
msgstr "Alle Tabs in 'Normal' umwandeln"

#: tfrmmain.actsetalltabsoptionpathlocked.caption
msgid "Set all tabs to Locked"
msgstr "Alle Tabs in 'Gesperrt' umwandeln"

#: tfrmmain.actsetalltabsoptionpathresets.caption
msgid "All tabs Locked with Dir Changes Allowed"
msgstr "Alle gesperrten Tabs, in denen Verzeichniswechsel erlaubt sind"

#: tfrmmain.actsetfileproperties.caption
msgctxt "TFRMMAIN.ACTSETFILEPROPERTIES.CAPTION"
msgid "Change &Attributes..."
msgstr "Dateieigensch&aften ändern..."

#: tfrmmain.actsettaboptiondirsinnewtab.caption
msgid "Locked with Directories Opened in New &Tabs"
msgstr "Gesperrt und Verzeichnisse in neuem Rei&ter öffnen"

#: tfrmmain.actsettaboptionnormal.caption
msgid "&Normal"
msgstr "&Normal"

#: tfrmmain.actsettaboptionpathlocked.caption
msgid "&Locked"
msgstr "&Gesperrt"

#: tfrmmain.actsettaboptionpathresets.caption
msgctxt "TFRMMAIN.ACTSETTABOPTIONPATHRESETS.CAPTION"
msgid "Locked with &Directory Changes Allowed"
msgstr "Gesperrt, aber &Verzeichniswechsel erlaubt"

#: tfrmmain.actshellexecute.caption
msgctxt "tfrmmain.actshellexecute.caption"
msgid "Open"
msgstr "Öffnen"

#: tfrmmain.actshellexecute.hint
msgid "Open using system associations"
msgstr "Öffnen anhand der System-eigenen Dateiverknüpfungen (außerhalb von Double Commander)"

#: tfrmmain.actshowbuttonmenu.caption
msgid "Show button menu"
msgstr "Button-Leiste anzeigen"

#: tfrmmain.actshowcmdlinehistory.caption
msgid "Show command line history"
msgstr "Befehlszeilenverlauf anzeigen"

#: tfrmmain.actshowmainmenu.caption
msgctxt "TFRMMAIN.ACTSHOWMAINMENU.CAPTION"
msgid "Menu"
msgstr "Menü"

#: tfrmmain.actshowsysfiles.caption
msgctxt "TFRMMAIN.ACTSHOWSYSFILES.CAPTION"
msgid "Show &Hidden/System Files"
msgstr "&Zeige versteckte und Systemdateien"

#: tfrmmain.actsortbyattr.caption
msgid "Sort by &Attributes"
msgstr "Nach &Attributen sortieren"

#: tfrmmain.actsortbydate.caption
msgid "Sort by &Date"
msgstr "Nach &Datum sortieren"

#: tfrmmain.actsortbyext.caption
msgid "Sort by &Extension"
msgstr "Nach &Endung sortieren"

#: tfrmmain.actsortbyname.caption
msgid "Sort by &Name"
msgstr "Nach &Name sortieren"

#: tfrmmain.actsortbysize.caption
msgid "Sort by &Size"
msgstr "Nach &Größe sortieren"

#: tfrmmain.actsrcopendrives.caption
msgid "Open drive list"
msgstr "Liste der Laufwerke öffnen"

#: tfrmmain.actswitchignorelist.caption
msgid "Enable/disable ignore list file to not show file names"
msgstr "De-/Aktivieren der Dateiliste um Dateinamen nicht anzuzeigen"

#: tfrmmain.actsymlink.caption
msgctxt "TFRMMAIN.ACTSYMLINK.CAPTION"
msgid "Create Symbolic &Link..."
msgstr "Erstelle symbolischen &Link..."

#: tfrmmain.actsyncdirs.caption
msgid "Synchronize dirs..."
msgstr "Sychronisiere Verzeichnisse..."

#: tfrmmain.acttargetequalsource.caption
msgid "Target &= Source"
msgstr "Ziel = &Quelle"

#: tfrmmain.acttestarchive.caption
msgid "&Test Archive(s)"
msgstr "Archiv(e) &testen"

#: tfrmmain.actthumbnailsview.caption
msgctxt "tfrmmain.actthumbnailsview.caption"
msgid "Thumbnails"
msgstr "Vorschaubilder"

#: tfrmmain.actthumbnailsview.hint
msgid "Thumbnails View"
msgstr "Vorschaubilder Ansicht"

#: tfrmmain.acttogglefullscreenconsole.caption
msgid "Toggle fullscreen mode console"
msgstr "Vollbild-Modus der Konsole umschalten"

#: tfrmmain.acttransferleft.caption
msgid "Transfer dir under cursor to left window"
msgstr "Bewege markierten &Ordner in das linke Fenster"

#: tfrmmain.acttransferright.caption
msgid "Transfer dir under cursor to right window"
msgstr "Bewege &markierten Ordner in das rechte Fenster"

#: tfrmmain.acttreeview.caption
msgid "&Tree View Panel"
msgstr "Baumansich&t-Panel"

#: tfrmmain.actuniversalsingledirectsort.caption
msgid "Sort according to parameters"
msgstr "Anhand von Parametern sortieren"

#: tfrmmain.actunmarkcurrentextension.caption
msgid "Unselect All with the Same Ex&tension"
msgstr "Alle mit gleicher E&ndung abwählen"

#: tfrmmain.actunmarkcurrentname.caption
msgid "Unselect all files with same name"
msgstr ""

#: tfrmmain.actunmarkcurrentnameext.caption
msgid "Unselect all files with same name and extension"
msgstr ""

#: tfrmmain.actunmarkcurrentpath.caption
msgid "Unselect all in same path"
msgstr ""

#: tfrmmain.actview.caption
msgctxt "tfrmmain.actview.caption"
msgid "View"
msgstr "Betrachten"

#: tfrmmain.actviewhistory.caption
msgid "Show history of visited paths for active view"
msgstr "Zeige den Verlauf der geöffneten Verzeichnisse des aktiven Panels"

#: tfrmmain.actviewhistorynext.caption
msgid "Go to next entry in history"
msgstr "Gehe zum nächsten Eintrag in der Verlaufsliste"

#: tfrmmain.actviewhistoryprev.caption
msgid "Go to previous entry in history"
msgstr "Gehe zum vorherigen Eintrag in der Verlaufsliste"

#: tfrmmain.actviewlogfile.caption
msgid "View log file"
msgstr "Log-Datei betrachten"

#: tfrmmain.actviewsearches.caption
msgid "View current search instances"
msgstr "Alle Such-Fenster anzeigen"

#: tfrmmain.actvisithomepage.caption
msgid "&Visit Double Commander Website"
msgstr "&Homepage von Double Commander öffnen"

#: tfrmmain.actwipe.caption
msgid "Wipe"
msgstr "Endgültig löschen"

#: tfrmmain.actworkwithdirectoryhotlist.caption
msgid "Work with Directory Hotlist and parameters"
msgstr "Mit der Verzeichnis-Hotlist und Parametern arbeiten"

#: tfrmmain.btnf10.caption
msgctxt "tfrmmain.btnf10.caption"
msgid "Exit"
msgstr "Beenden"

#: tfrmmain.btnf7.caption
msgctxt "tfrmmain.btnf7.caption"
msgid "Directory"
msgstr "Verzeichnis"

#: tfrmmain.btnf8.caption
msgctxt "TFRMMAIN.BTNF8.CAPTION"
msgid "Delete"
msgstr "Löschen"

#: tfrmmain.btnf9.caption
msgctxt "tfrmmain.btnf9.caption"
msgid "Terminal"
msgstr "Terminal"

#: tfrmmain.btnleftdirectoryhotlist.caption
msgctxt "TFRMMAIN.BTNLEFTDIRECTORYHOTLIST.CAPTION"
msgid "*"
msgstr "*"

#: tfrmmain.btnleftdirectoryhotlist.hint
msgctxt "tfrmmain.btnleftdirectoryhotlist.hint"
msgid "Directory Hotlist"
msgstr "Favoriten für Verzeichnisse"

#: tfrmmain.btnleftequalright.caption
msgctxt "tfrmmain.btnleftequalright.caption"
msgid "<"
msgstr "<"

#: tfrmmain.btnleftequalright.hint
msgid "Show current directory of the right panel in the left panel"
msgstr "Aktuelles Verzeichnis der rechten Seite auch auf der linken Seite anzeigen"

#: tfrmmain.btnlefthome.caption
msgctxt "TFRMMAIN.BTNLEFTHOME.CAPTION"
msgid "~"
msgstr "~"

#: tfrmmain.btnlefthome.hint
msgid "Go to home directory"
msgstr "zu Benutzerverzeichnis wechseln"

#: tfrmmain.btnleftroot.caption
msgctxt "TFRMMAIN.BTNLEFTROOT.CAPTION"
msgid "/"
msgstr "/"

#: tfrmmain.btnleftroot.hint
msgid "Go to root directory"
msgstr "Zum Root-Verzeichnis wechseln"

#: tfrmmain.btnleftup.caption
msgctxt "TFRMMAIN.BTNLEFTUP.CAPTION"
msgid ".."
msgstr ".."

#: tfrmmain.btnleftup.hint
msgid "Go to parent directory"
msgstr "Zum übergeordneten Verzeichnis wechseln"

#: tfrmmain.btnrightdirectoryhotlist.caption
msgctxt "TFRMMAIN.BTNRIGHTDIRECTORYHOTLIST.CAPTION"
msgid "*"
msgstr "*"

#: tfrmmain.btnrightdirectoryhotlist.hint
msgctxt "tfrmmain.btnrightdirectoryhotlist.hint"
msgid "Directory Hotlist"
msgstr "Verzeichnis-Hotlist"

#: tfrmmain.btnrightequalleft.caption
msgctxt "tfrmmain.btnrightequalleft.caption"
msgid ">"
msgstr ">"

#: tfrmmain.btnrightequalleft.hint
msgid "Show current directory of the left panel in the right panel"
msgstr "Aktuelles Verzeichnis der linken Seite auch auf der rechten Seite anzeigen"

#: tfrmmain.btnrighthome.caption
msgctxt "TFRMMAIN.BTNRIGHTHOME.CAPTION"
msgid "~"
msgstr "~"

#: tfrmmain.btnrightroot.caption
msgctxt "TFRMMAIN.BTNRIGHTROOT.CAPTION"
msgid "/"
msgstr "/"

#: tfrmmain.btnrightup.caption
msgctxt "TFRMMAIN.BTNRIGHTUP.CAPTION"
msgid ".."
msgstr ".."

#: tfrmmain.caption
msgctxt "tfrmmain.caption"
msgid "Double Commander"
msgstr "Double Commander"

#: tfrmmain.lblcommandpath.caption
msgctxt "TFRMMAIN.LBLCOMMANDPATH.CAPTION"
msgid "Path"
msgstr "Pfad"

#: tfrmmain.menuitem2.caption
msgctxt "TFRMMAIN.MENUITEM2.CAPTION"
msgid "-"
msgstr "-"

#: tfrmmain.mi2080.caption
msgid "&20/80"
msgstr "&20/80"

#: tfrmmain.mi3070.caption
msgid "&30/70"
msgstr "&30/70"

#: tfrmmain.mi4060.caption
msgid "&40/60"
msgstr "&40/60"

#: tfrmmain.mi5050.caption
msgid "&50/50"
msgstr "&50/50"

#: tfrmmain.mi6040.caption
msgid "&60/40"
msgstr "&60/40"

#: tfrmmain.mi7030.caption
msgid "&70/30"
msgstr "&70/30"

#: tfrmmain.mi8020.caption
msgid "&80/20"
msgstr "&80/20"

#: tfrmmain.micancel.caption
msgctxt "TFRMMAIN.MICANCEL.CAPTION"
msgid "Cancel"
msgstr "Abbrechen"

#: tfrmmain.micopy.caption
msgid "Copy..."
msgstr "Kopiere..."

#: tfrmmain.mihardlink.caption
msgctxt "TFRMMAIN.MIHARDLINK.CAPTION"
msgid "Create link..."
msgstr "Hardlink erstellen..."

#: tfrmmain.miline1.caption
msgctxt "TFRMMAIN.MILINE1.CAPTION"
msgid "-"
msgstr "-"

#: tfrmmain.miline10.caption
msgctxt "tfrmmain.miline10.caption"
msgid "-"
msgstr "-"

#: tfrmmain.miline11.caption
msgctxt "tfrmmain.miline11.caption"
msgid "-"
msgstr "-"

#: tfrmmain.miline12.caption
msgctxt "TFRMMAIN.MILINE12.CAPTION"
msgid "-"
msgstr "-"

#: tfrmmain.miline13.caption
msgctxt "TFRMMAIN.MILINE13.CAPTION"
msgid "-"
msgstr "-"

#: tfrmmain.miline14.caption
msgctxt "TFRMMAIN.MILINE14.CAPTION"
msgid "-"
msgstr "-"

#: tfrmmain.miline15.caption
msgctxt "TFRMMAIN.MILINE15.CAPTION"
msgid "-"
msgstr "-"

#: tfrmmain.miline16.caption
msgctxt "TFRMMAIN.MILINE16.CAPTION"
msgid "-"
msgstr "-"

#: tfrmmain.miline17.caption
msgctxt "TFRMMAIN.MILINE17.CAPTION"
msgid "-"
msgstr "-"

#: tfrmmain.miline18.caption
msgctxt "TFRMMAIN.MILINE18.CAPTION"
msgid "-"
msgstr "-"

#: tfrmmain.miline19.caption
msgctxt "TFRMMAIN.MILINE19.CAPTION"
msgid "-"
msgstr "-"

#: tfrmmain.miline2.caption
msgctxt "TFRMMAIN.MILINE2.CAPTION"
msgid "-"
msgstr "-"

#: tfrmmain.miline20.caption
msgctxt "TFRMMAIN.MILINE20.CAPTION"
msgid "-"
msgstr "-"

#: tfrmmain.miline21.caption
msgctxt "tfrmmain.miline21.caption"
msgid "-"
msgstr "-"

#: tfrmmain.miline22.caption
msgctxt "TFRMMAIN.MILINE22.CAPTION"
msgid "-"
msgstr "-"

#: tfrmmain.miline23.caption
msgctxt "tfrmmain.miline23.caption"
msgid "-"
msgstr "-"

#: tfrmmain.miline24.caption
msgctxt "TFRMMAIN.MILINE24.CAPTION"
msgid "-"
msgstr "-"

#: tfrmmain.miline25.caption
msgctxt "TFRMMAIN.MILINE25.CAPTION"
msgid "-"
msgstr "-"

#: tfrmmain.miline26.caption
msgctxt "tfrmmain.miline26.caption"
msgid "-"
msgstr "-"

#: tfrmmain.miline3.caption
msgctxt "TFRMMAIN.MILINE3.CAPTION"
msgid "-"
msgstr "-"

#: tfrmmain.miline32.caption
msgctxt "TFRMMAIN.MILINE32.CAPTION"
msgid "-"
msgstr "-"

#: tfrmmain.miline33.caption
msgctxt "tfrmmain.miline33.caption"
msgid "-"
msgstr "-"

#: tfrmmain.miline37.caption
msgctxt "TFRMMAIN.MILINE37.CAPTION"
msgid "-"
msgstr "-"

#: tfrmmain.miline38.caption
msgctxt "tfrmmain.miline38.caption"
msgid "-"
msgstr "-"

#: tfrmmain.miline39.caption
msgctxt "tfrmmain.miline39.caption"
msgid "-"
msgstr "-"

#: tfrmmain.miline4.caption
msgctxt "TFRMMAIN.MILINE4.CAPTION"
msgid "-"
msgstr "-"

#: tfrmmain.miline40.caption
msgctxt "tfrmmain.miline40.caption"
msgid "-"
msgstr "-"

#: tfrmmain.miline47.caption
msgctxt "TFRMMAIN.MILINE47.CAPTION"
msgid "-"
msgstr "-"

#: tfrmmain.miline5.caption
msgctxt "TFRMMAIN.MILINE5.CAPTION"
msgid "-"
msgstr "-"

#: tfrmmain.miline50.caption
msgctxt "tfrmmain.miline50.caption"
msgid "-"
msgstr "-"

#: tfrmmain.miline55.caption
#, fuzzy
msgctxt "tfrmmain.miline55.caption"
msgid "-"
msgstr "-"

#: tfrmmain.miline6.caption
msgctxt "TFRMMAIN.MILINE6.CAPTION"
msgid "-"
msgstr "-"

#: tfrmmain.miline7.caption
msgctxt "TFRMMAIN.MILINE7.CAPTION"
msgid "-"
msgstr "-"

#: tfrmmain.miline8.caption
msgctxt "TFRMMAIN.MILINE8.CAPTION"
msgid "-"
msgstr "-"

#: tfrmmain.miline9.caption
msgctxt "TFRMMAIN.MILINE9.CAPTION"
msgid "-"
msgstr "-"

#: tfrmmain.milogclear.caption
msgid "Clear"
msgstr "Leeren"

#: tfrmmain.milogcopy.caption
msgctxt "TFRMMAIN.MILOGCOPY.CAPTION"
msgid "Copy"
msgstr "Kopieren"

#: tfrmmain.miloghide.caption
msgid "Hide"
msgstr "Verstecken"

#: tfrmmain.milogselectall.caption
msgctxt "TFRMMAIN.MILOGSELECTALL.CAPTION"
msgid "Select All"
msgstr "Alle mar&kieren"

#: tfrmmain.mimove.caption
msgid "Move..."
msgstr "Verschiebe..."

#: tfrmmain.misymlink.caption
msgctxt "TFRMMAIN.MISYMLINK.CAPTION"
msgid "Create symlink..."
msgstr "Erstelle symbolischen Link"

#: tfrmmain.mitaboptions.caption
msgid "Tab options"
msgstr "Tab-Optionen"

#: tfrmmain.mitrayiconexit.caption
msgctxt "TFRMMAIN.MITRAYICONEXIT.CAPTION"
msgid "E&xit"
msgstr "&Beenden"

#: tfrmmain.mitrayiconrestore.caption
msgid "Restore"
msgstr "Wiederherstellen"

#: tfrmmain.mnualloperpause.caption
msgctxt "tfrmmain.mnualloperpause.caption"
msgid "||"
msgstr "||"

#: tfrmmain.mnualloperstart.caption
msgctxt "tfrmmain.mnualloperstart.caption"
msgid "Start"
msgstr "Start"

#: tfrmmain.mnualloperstop.caption
msgctxt "tfrmmain.mnualloperstop.caption"
msgid "Cancel"
msgstr "Abbrechen"

#: tfrmmain.mnucmd.caption
msgid "&Commands"
msgstr "&Befehle"

#: tfrmmain.mnuconfig.caption
msgid "C&onfiguration"
msgstr "K&onfigurieren"

#: tfrmmain.mnucontextline1.caption
msgctxt "tfrmmain.mnucontextline1.caption"
msgid "-"
msgstr "-"

#: tfrmmain.mnucontextline2.caption
msgctxt "tfrmmain.mnucontextline2.caption"
msgid "-"
msgstr "-"

#: tfrmmain.mnufavoritetabs.caption
msgid "Favorites"
msgstr "&Favoriten"

#: tfrmmain.mnufiles.caption
msgid "&Files"
msgstr "&Dateien"

#: tfrmmain.mnuhelp.caption
msgctxt "TFRMMAIN.MNUHELP.CAPTION"
msgid "&Help"
msgstr "&Hilfe"

#: tfrmmain.mnumark.caption
msgid "&Mark"
msgstr "&Markieren"

#: tfrmmain.mnunetwork.caption
msgctxt "TFRMMAIN.MNUNETWORK.CAPTION"
msgid "Network"
msgstr "&Netzwerk"

#: tfrmmain.mnushow.caption
msgid "&Show"
msgstr "&Ansicht"

#: tfrmmain.mnutaboptions.caption
msgctxt "TFRMMAIN.MNUTABOPTIONS.CAPTION"
msgid "Tab &Options"
msgstr "Tab &Optionen..."

#: tfrmmain.mnutabs.caption
msgid "&Tabs"
msgstr "&Tabs"

#: tfrmmain.tbchangedir.caption
msgid "CD"
msgstr "Verzeichnis-Wechsel"

#: tfrmmain.tbcopy.caption
msgctxt "TFRMMAIN.TBCOPY.CAPTION"
msgid "Copy"
msgstr "Kopieren"

#: tfrmmain.tbcut.caption
msgctxt "TFRMMAIN.TBCUT.CAPTION"
msgid "Cut"
msgstr "Ausschneiden"

#: tfrmmain.tbdelete.caption
msgctxt "TFRMMAIN.TBDELETE.CAPTION"
msgid "Delete"
msgstr "&Löschen"

#: tfrmmain.tbedit.caption
msgctxt "TFRMMAIN.TBEDIT.CAPTION"
msgid "Edit"
msgstr "Bea&rbeiten"

#: tfrmmain.tbpaste.caption
msgctxt "TFRMMAIN.TBPASTE.CAPTION"
msgid "Paste"
msgstr "Einfügen"

#: tfrmmain.tbseparator.caption
msgctxt "TFRMMAIN.TBSEPARATOR.CAPTION"
msgid "-"
msgstr "-"

#: tfrmmaincommandsdlg.btncancel.caption
msgctxt "tfrmmaincommandsdlg.btncancel.caption"
msgid "&Cancel"
msgstr "&Abbrechen"

#: tfrmmaincommandsdlg.btnok.caption
msgctxt "tfrmmaincommandsdlg.btnok.caption"
msgid "&OK"
msgstr "&OK"

#: tfrmmaincommandsdlg.caption
msgid "Select your internal command"
msgstr "Internen Befehl auswählen"

#: tfrmmaincommandsdlg.cbcategorysortornot.text
msgctxt "tfrmmaincommandsdlg.cbcategorysortornot.text"
msgid "Legacy sorted"
msgstr "Auf alte Art sortiert"

#: tfrmmaincommandsdlg.cbcommandssortornot.text
msgctxt "tfrmmaincommandsdlg.cbcommandssortornot.text"
msgid "Legacy sorted"
msgstr "Auf alte Art sortiert"

#: tfrmmaincommandsdlg.cbselectallcategorydefault.caption
msgid "Select all categories by default"
msgstr "Alle Kategorien nach Standard sortieren"

#: tfrmmaincommandsdlg.gbselection.caption
msgid "Selection:"
msgstr "Auswahl:"

#: tfrmmaincommandsdlg.lblcategory.caption
msgid "&Categories:"
msgstr "Kategorien:"

#: tfrmmaincommandsdlg.lblcommandname.caption
msgid "Command &name:"
msgstr "Befehls&name:"

#: tfrmmaincommandsdlg.lbledtfilter.editlabel.caption
msgid "&Filter:"
msgstr "&Filter:"

#: tfrmmaincommandsdlg.lblhint.caption
msgid "Hint:"
msgstr "Hinweis:"

#: tfrmmaincommandsdlg.lblhotkey.caption
msgid "Hotkey:"
msgstr "Tastaturkürzel:"

#: tfrmmaincommandsdlg.lblselectedcommand.caption
msgid "cm_name"
msgstr ""

#: tfrmmaincommandsdlg.lblselectedcommandcategory.caption
msgctxt "tfrmmaincommandsdlg.lblselectedcommandcategory.caption"
msgid "Category"
msgstr "Kategorie"

#: tfrmmaincommandsdlg.lblselectedcommandhelp.caption
msgctxt "tfrmmaincommandsdlg.lblselectedcommandhelp.caption"
msgid "Help"
msgstr "Hilfe"

#: tfrmmaincommandsdlg.lblselectedcommandhint.caption
msgid "Hint"
msgstr "Hinweis"

#: tfrmmaincommandsdlg.lblselectedcommandhotkey.caption
msgctxt "tfrmmaincommandsdlg.lblselectedcommandhotkey.caption"
msgid "Hotkey"
msgstr "Tastaturkürzel"

#: tfrmmaskinputdlg.btnaddattribute.caption
#, fuzzy
msgctxt "tfrmmaskinputdlg.btnaddattribute.caption"
msgid "&Add"
msgstr "&Hinzufügen"

#: tfrmmaskinputdlg.btnattrshelp.caption
#, fuzzy
msgctxt "tfrmmaskinputdlg.btnattrshelp.caption"
msgid "&Help"
msgstr "&Hilfe"

#: tfrmmaskinputdlg.btncancel.caption
msgctxt "TFRMMASKINPUTDLG.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Abbrechen"

#: tfrmmaskinputdlg.btndefinetemplate.caption
msgid "&Define..."
msgstr "&Definieren..."

#: tfrmmaskinputdlg.btnok.caption
msgctxt "TFRMMASKINPUTDLG.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"

#: tfrmmaskinputdlg.chkcasesensitive.caption
msgid "Case sensitive"
msgstr "Abhängig von der Schreibweise"

#: tfrmmaskinputdlg.chkignoreaccentsandligatures.caption
msgid "Ignore accents and ligatures"
msgstr ""

#: tfrmmaskinputdlg.lblattributes.caption
msgid "Attri&butes:"
msgstr ""

#: tfrmmaskinputdlg.lblprompt.caption
msgid "Input Mask:"
msgstr "Eingabemaske:"

#: tfrmmaskinputdlg.lblsearchtemplate.caption
msgid "O&r select predefined selection type:"
msgstr "Ode&r vordefinierten Auswahltyp wählen:"

#: tfrmmkdir.btncancel.caption
msgctxt "TFRMMKDIR.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Abbrechen"

#: tfrmmkdir.btnok.caption
msgctxt "TFRMMKDIR.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"

#: tfrmmkdir.caption
msgid "Create new directory"
msgstr "Neues Verzeichnis anlegen"

#: tfrmmkdir.lblmakedir.caption
msgid "&Input new directory name:"
msgstr "Namen für neues Verze&ichnis eingeben"

#: tfrmmodview.btnpath1.caption
msgctxt "TFRMMODVIEW.BTNPATH1.CAPTION"
msgid "..."
msgstr "..."

#: tfrmmodview.btnpath2.caption
msgctxt "TFRMMODVIEW.BTNPATH2.CAPTION"
msgid "..."
msgstr "..."

#: tfrmmodview.btnpath3.caption
msgctxt "TFRMMODVIEW.BTNPATH3.CAPTION"
msgid "..."
msgstr "..."

#: tfrmmodview.btnpath4.caption
msgctxt "TFRMMODVIEW.BTNPATH4.CAPTION"
msgid "..."
msgstr "..."

#: tfrmmodview.btnpath5.caption
msgctxt "TFRMMODVIEW.BTNPATH5.CAPTION"
msgid "..."
msgstr "..."

#: tfrmmodview.caption
msgctxt "TFRMMODVIEW.CAPTION"
msgid "New Size"
msgstr "Neue Größe"

#: tfrmmodview.lblheight.caption
msgid "Height :"
msgstr "Höhe :"

#: tfrmmodview.lblpath1.caption
msgctxt "TFRMMODVIEW.LBLPATH1.CAPTION"
msgid "1"
msgstr "1"

#: tfrmmodview.lblpath2.caption
msgid "2"
msgstr "2"

#: tfrmmodview.lblpath3.caption
msgid "3"
msgstr "3"

#: tfrmmodview.lblpath4.caption
msgid "4"
msgstr "4"

#: tfrmmodview.lblpath5.caption
msgid "5"
msgstr "5"

#: tfrmmodview.lblquality.caption
msgid "Quality of compress to Jpg"
msgstr "Kompressions-Qualität für Jpg"

#: tfrmmodview.lblwidth.caption
msgid "Width :"
msgstr "Breite :"

#: tfrmmodview.rbbmp.caption
msgid "BMP"
msgstr "BMP"

#: tfrmmodview.rbico.caption
msgid "ICO"
msgstr "ICO"

#: tfrmmodview.rbjpg.caption
msgid "JPG"
msgstr "JPG"

#: tfrmmodview.rbpng.caption
msgid "PNG"
msgstr "PNG"

#: tfrmmodview.rbpnm.caption
msgid "PNM"
msgstr "PNM"

#: tfrmmodview.teheight.text
msgctxt "tfrmmodview.teheight.text"
msgid "Height"
msgstr "Höhe"

#: tfrmmodview.tequality.text
msgid "80"
msgstr "80"

#: tfrmmodview.tewidth.text
msgctxt "TFRMMODVIEW.TEWIDTH.TEXT"
msgid "Width"
msgstr "Breite"

#: tfrmmsg.lblmsg.caption
msgid "456456465465465"
msgstr ""

#: tfrmmultirename.btnclose.caption
msgctxt "TFRMMULTIRENAME.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "S&chließen"

#: tfrmmultirename.btndeletepreset.caption
msgctxt "TFRMMULTIRENAME.BTNDELETEPRESET.CAPTION"
msgid "&Delete"
msgstr "L&öschen"

#: tfrmmultirename.btnedit.caption
#, fuzzy
msgctxt "tfrmmultirename.btnedit.caption"
msgid "&Edit"
msgstr "B&earbeiten"

#: tfrmmultirename.btnextmenu.caption
msgctxt "TFRMMULTIRENAME.BTNEXTMENU.CAPTION"
msgid "..."
msgstr "..."

#: tfrmmultirename.btnloadpreset.caption
msgid "&Load"
msgstr "&Laden"

#: tfrmmultirename.btnnamemenu.caption
msgctxt "TFRMMULTIRENAME.BTNNAMEMENU.CAPTION"
msgid "..."
msgstr "..."

#: tfrmmultirename.btnrename.caption
msgctxt "tfrmmultirename.btnrename.caption"
msgid "&Rename"
msgstr "&Umbenennen"

#: tfrmmultirename.btnrestore.caption
msgid "Reset &all"
msgstr "&Alles zurücksetzen"

#: tfrmmultirename.btnsavepreset.caption
msgctxt "TFRMMULTIRENAME.BTNSAVEPRESET.CAPTION"
msgid "&Save"
msgstr "&Speichern"

#: tfrmmultirename.caption
msgctxt "tfrmmultirename.caption"
msgid "MultiRename"
msgstr "Mehrfaches Umbenennen"

#: tfrmmultirename.cblog.caption
msgctxt "TFRMMULTIRENAME.CBLOG.CAPTION"
msgid "Ena&ble"
msgstr "Akti&vieren"

#: tfrmmultirename.cbregexp.caption
msgctxt "TFRMMULTIRENAME.CBREGEXP.CAPTION"
msgid "Regular e&xpressions"
msgstr "&Reguläre Ausdrücke"

#: tfrmmultirename.cbusesubs.caption
msgid "&Use substitution"
msgstr "N&utze Ersetzung"

#: tfrmmultirename.cmbxwidth.text
msgid "01"
msgstr "01"

#: tfrmmultirename.edinterval.text
msgctxt "TFRMMULTIRENAME.EDINTERVAL.TEXT"
msgid "1"
msgstr "1"

#: tfrmmultirename.edpoc.text
msgctxt "TFRMMULTIRENAME.EDPOC.TEXT"
msgid "1"
msgstr "1"

#: tfrmmultirename.extension.caption
msgid "[E] Extension"
msgstr "[E]ndung"

#: tfrmmultirename.gbcounter.caption
msgid "Counter"
msgstr "Zähler"

#: tfrmmultirename.gbfindreplace.caption
msgid "Find && Replace"
msgstr "Suchen und e&rsetzen"

#: tfrmmultirename.gblog.caption
msgid "Log Result"
msgstr "Log-Ergebnis"

#: tfrmmultirename.gbmaska.caption
msgid "Mask"
msgstr "Maske"

#: tfrmmultirename.gbpresets.caption
msgid "Presets"
msgstr "Vorgaben"

#: tfrmmultirename.lbext.caption
msgid "&Extension"
msgstr "&Endung"

#: tfrmmultirename.lbfind.caption
msgid "&Find..."
msgstr "Su&che..."

#: tfrmmultirename.lbinterval.caption
msgid "&Interval"
msgstr "&Interval"

#: tfrmmultirename.lbname.caption
msgid "File &Name"
msgstr "Datei&name"

#: tfrmmultirename.lbreplace.caption
msgid "Re&place..."
msgstr "Er&setze..."

#: tfrmmultirename.lbstnb.caption
msgid "S&tart Number"
msgstr "S&tarten bei"

#: tfrmmultirename.lbwidth.caption
msgctxt "TFRMMULTIRENAME.LBWIDTH.CAPTION"
msgid "&Width"
msgstr "&Breite"

#: tfrmmultirename.micounter.caption
msgid "[C] Counter"
msgstr "[C] Zählweise"

#: tfrmmultirename.miday.caption
msgid "[D] Day"
msgstr "[D] Tag"

#: tfrmmultirename.miday1.caption
msgid "[DD] Day (2 digits)"
msgstr "[DD] Tag (zweistellig)"

#: tfrmmultirename.miday2.caption
msgid "[DDD] Day of the week (short, e.g., \"mon\")"
msgstr "[DDD] Tag der Woche (kurz, z. B. \"Mo\")"

#: tfrmmultirename.miday3.caption
msgid "[DDDD] Day of the week (long, e.g., \"monday\")"
msgstr "[DDDD] Tag der Woche (lang, z. B. \"Montag\")"

#: tfrmmultirename.miextensionx.caption
msgid "[Ex] Character at position x"
msgstr "[Ex]Bezeichnung an Position x"

#: tfrmmultirename.miextensionxx.caption
msgid "[Ex:y] Characters from position x to y"
msgstr "[Ex:y]Bezeichnung von Positionx bis y"

#: tfrmmultirename.mihour.caption
msgid "[h] Hour"
msgstr "[h] Stunde"

#: tfrmmultirename.mihour1.caption
msgid "[hh] Hour (2 digits)"
msgstr "[hh] Stunde (zweistellig)"

#: tfrmmultirename.miminute.caption
msgid "[n] Minute"
msgstr "[n] Minute"

#: tfrmmultirename.miminute1.caption
msgid "[nn] Minute (2 digits)"
msgstr "[nn] Minute (zweistellig)"

#: tfrmmultirename.mimonth.caption
msgid "[M] Month"
msgstr "[M] Monat"

#: tfrmmultirename.mimonth1.caption
msgid "[MM] Month (2 digits)"
msgstr "[MM] Monat (zweistellig)"

#: tfrmmultirename.mimonth2.caption
msgid "[MMM] Month name (short, e.g., \"jan\")"
msgstr "[MMM] Monatsname (kurz, z. B. \"Jan\")"

#: tfrmmultirename.mimonth3.caption
msgid "[MMMM] Month name (long, e.g., \"january\")"
msgstr "[MMMM] Monatsname (lang, z. B. \"Januar\")"

#: tfrmmultirename.miname.caption
msgid "[N] Name"
msgstr "[N] Name"

#: tfrmmultirename.minamex.caption
msgid "[Nx] Character at position x"
msgstr "[Nx] Bezeichnung an Position x"

#: tfrmmultirename.minamexx.caption
msgid "[Nx:y] Characters from position x to y"
msgstr "[Nx:y] Bezeichnung von Position x bis y"

#: tfrmmultirename.minext.caption
msgid "Time..."
msgstr "Zeit..."

#: tfrmmultirename.minextextension.caption
msgid "Extension..."
msgstr "Endung..."

#: tfrmmultirename.minextname.caption
msgid "Name..."
msgstr "Name..."

#: tfrmmultirename.miplugin.caption
msgctxt "TFRMMULTIRENAME.MIPLUGIN.CAPTION"
msgid "Plugin"
msgstr "Plugin"

#: tfrmmultirename.misecond.caption
msgid "[s] Second"
msgstr "[S] Sekunde"

#: tfrmmultirename.misecond1.caption
msgid "[ss] Second (2 digits)"
msgstr "[ss] Sekunde (zweistellig)"

#: tfrmmultirename.miyear.caption
msgid "[Y] Year (2 digits)"
msgstr "[Y] Jahr (zweistellig)"

#: tfrmmultirename.miyear1.caption
msgid "[YYYY] Year (4 digits)"
msgstr "[YYYY] Jahr (vierstellig)"

#: tfrmmultirename.mnueditnames.caption
msgid "Edit names..."
msgstr ""

#: tfrmmultirename.mnuloadfromfile.caption
msgid "Load names from file..."
msgstr ""

#: tfrmmultirename.n1.caption
msgctxt "TFRMMULTIRENAME.N1.CAPTION"
msgid "-"
msgstr "-"

#: tfrmmultirename.n2.caption
msgctxt "TFRMMULTIRENAME.N2.CAPTION"
msgid "-"
msgstr "-"

#: tfrmmultirename.n3.caption
msgctxt "TFRMMULTIRENAME.N3.CAPTION"
msgid "-"
msgstr "-"

#: tfrmmultirename.n4.caption
msgctxt "TFRMMULTIRENAME.N4.CAPTION"
msgid "-"
msgstr "-"

#: tfrmmultirename.n5.caption
msgctxt "TFRMMULTIRENAME.N5.CAPTION"
msgid "-"
msgstr "-"

#: tfrmmultirename.stringgrid.columns[0].title.caption
msgctxt "tfrmmultirename.stringgrid.columns[0].title.caption"
msgid "Old File Name"
msgstr "Vorheriger Dateiname"

#: tfrmmultirename.stringgrid.columns[1].title.caption
msgctxt "tfrmmultirename.stringgrid.columns[1].title.caption"
msgid "New File Name"
msgstr "Neuer Dateiname"

#: tfrmmultirename.stringgrid.columns[2].title.caption
msgctxt "tfrmmultirename.stringgrid.columns[2].title.caption"
msgid "File Path"
msgstr "Dateipfad"

#: tfrmmultirenamewait.caption
msgctxt "tfrmmultirenamewait.caption"
msgid "Double Commander"
msgstr "Double Commander"

#: tfrmmultirenamewait.lblmessage.caption
msgid "Click OK when you have closed the editor to load the changed names!"
msgstr ""

#: tfrmopenwith.caption
msgid "Choose an application"
msgstr "Anwendung auswählen"

#: tfrmopenwith.chkcustomcommand.caption
msgid "Custom command"
msgstr "Angepasster Befehl"

#: tfrmopenwith.chksaveassociation.caption
msgid "Save association"
msgstr "Verknüpfung speichern"

#: tfrmopenwith.chkuseasdefault.caption
msgid "Set selected application as default action"
msgstr "Gewählte Aktion als Standard festlegen"

#: tfrmopenwith.lblmimetype.caption
msgid "File type to be opened: %s"
msgstr "Dateityp zum Öffnen: %s"

#: tfrmopenwith.milistoffiles.caption
msgid "Multiple file names"
msgstr "Mehrere Dateinamen"

#: tfrmopenwith.milistoffiles.hint
msgid "%F"
msgstr ""

#: tfrmopenwith.milistofurls.caption
msgid "Multiple URIs"
msgstr "Mehrere URL"

#: tfrmopenwith.milistofurls.hint
msgid "%U"
msgstr ""

#: tfrmopenwith.misinglefilename.caption
msgid "Single file name"
msgstr "Einzelner Dateiname"

#: tfrmopenwith.misinglefilename.hint
msgid "%f"
msgstr ""

#: tfrmopenwith.misingleurl.caption
msgid "Single URI"
msgstr "Einzelne URL"

#: tfrmopenwith.misingleurl.hint
msgid "%u"
msgstr ""

#: tfrmoptions.btnapply.caption
msgid "&Apply"
msgstr "&Übernehmen"

#: tfrmoptions.btncancel.caption
msgctxt "TFRMOPTIONS.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Abbrechen"

#: tfrmoptions.btnok.caption
msgctxt "TFRMOPTIONS.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"

#: tfrmoptions.caption
msgctxt "tfrmoptions.caption"
msgid "Options"
msgstr "Optionen"

#: tfrmoptions.lblemptyeditor.caption
msgid "Please select one of the subpages, this page does not contain any settings."
msgstr "Bitte eine der Unterseiten auswählen, diese Seite hier enthält keine Einstellmöglichkeiten."

#: tfrmoptionsarchivers.btnautoconfig.caption
msgctxt "TFRMOPTIONSARCHIVERS.BTNAUTOCONFIG.CAPTION"
msgid "A&uto Configure"
msgstr "A&uto-Konfiguration"

#: tfrmoptionsarchivers.btnmultiarcadd.caption
msgctxt "TFRMOPTIONSARCHIVERS.BTNMULTIARCADD.CAPTION"
msgid "A&dd"
msgstr "&Hinzufügen"

#: tfrmoptionsarchivers.btnmultiarcapply.caption
msgctxt "TFRMOPTIONSARCHIVERS.BTNMULTIARCAPPLY.CAPTION"
msgid "A&pply"
msgstr "&Übernehmen"

#: tfrmoptionsarchivers.btnmultiarcdelete.caption
msgctxt "TFRMOPTIONSARCHIVERS.BTNMULTIARCDELETE.CAPTION"
msgid "D&elete"
msgstr "&Löschen"

#: tfrmoptionsarchivers.btnmultiarcrename.caption
msgctxt "TFRMOPTIONSARCHIVERS.BTNMULTIARCRENAME.CAPTION"
msgid "&Rename"
msgstr "&Umbenennen"

#: tfrmoptionsarchivers.btnrelativearchiver.hint
msgctxt "tfrmoptionsarchivers.btnrelativearchiver.hint"
msgid "Some functions to select appropriate path"
msgstr "Einige Funktionen um angemessene Pfade zu wählen"

#: tfrmoptionsarchivers.chkmultiarcdebug.caption
msgctxt "TFRMOPTIONSARCHIVERS.CHKMULTIARCDEBUG.CAPTION"
msgid "De&bug mode"
msgstr "De&bug-Modus"

#: tfrmoptionsarchivers.chkmultiarcenabled.caption
msgid "E&nabled"
msgstr "A&ktiviert"

#: tfrmoptionsarchivers.chkmultiarcoutput.caption
msgctxt "TFRMOPTIONSARCHIVERS.CHKMULTIARCOUTPUT.CAPTION"
msgid "S&how console output"
msgstr "&Zeige die Ausgabe des Konsolenfensters"

#: tfrmoptionsarchivers.gbarchiveroptions.caption
msgctxt "TFRMOPTIONSARCHIVERS.GBARCHIVEROPTIONS.CAPTION"
msgid "Options"
msgstr "Optionen"

#: tfrmoptionsarchivers.lblarchiveadd.caption
msgid "Add&ing:"
msgstr "H&inzufügen:"

#: tfrmoptionsarchivers.lblarchiveextension.caption
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVEEXTENSION.CAPTION"
msgid "E&xtension:"
msgstr "&Endung:"

#: tfrmoptionsarchivers.lblarchiveextract.caption
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVEEXTRACT.CAPTION"
msgid "Ex&tract:"
msgstr "En&tpacken:"

#: tfrmoptionsarchivers.lblarchivelist.caption
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVELIST.CAPTION"
msgid "&List:"
msgstr "&Liste:"

#: tfrmoptionsarchivers.lblarchivelistend.caption
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVELISTEND.CAPTION"
msgid "Listing &finish (optional):"
msgstr "Aufli&stungsende (optional):"

#: tfrmoptionsarchivers.lblarchivelistformat.caption
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVELISTFORMAT.CAPTION"
msgid "Listing for&mat:"
msgstr "Auflistungsfor&mat"

#: tfrmoptionsarchivers.lblarchiveliststart.caption
msgid "Listin&g start (optional):"
msgstr "Auflistun&gsbeginn (optional):"

#: tfrmoptionsarchivers.lblarchiver.caption
msgctxt "TFRMOPTIONSARCHIVERS.LBLARCHIVER.CAPTION"
msgid "Arc&hiver:"
msgstr "Arc&hivierer:"

#: tfrmoptionsarchivers.lbldescription.caption
msgctxt "TFRMOPTIONSARCHIVERS.LBLDESCRIPTION.CAPTION"
msgid "De&scription:"
msgstr "Be&schreibung:"

#: tfrmoptionsarchivers.tbarchiveradditional.caption
msgctxt "TFRMOPTIONSARCHIVERS.TBARCHIVERADDITIONAL.CAPTION"
msgid "Additional"
msgstr "Zusätzlich"

#: tfrmoptionsarchivers.tbarchivergeneral.caption
msgctxt "TFRMOPTIONSARCHIVERS.TBARCHIVERGENERAL.CAPTION"
msgid "General"
msgstr "Allgemein"

#: tfrmoptionsautorefresh.cbwatchattributeschange.caption
msgid "When &size, date or attributes change"
msgstr "wenn &Größe, Datum oder Attribute geändert werden"

#: tfrmoptionsautorefresh.cbwatchexcludedirs.caption
msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHEXCLUDEDIRS.CAPTION"
msgid "For the following &paths and their subdirectories:"
msgstr "Für die &folgenden Pfade und Unterverzeichnisse:"

#: tfrmoptionsautorefresh.cbwatchfilenamechange.caption
msgid "When &files are created, deleted or renamed"
msgstr "wenn Dateien erstellt, gelöscht oder umbenannt werden"

#: tfrmoptionsautorefresh.cbwatchonlyforeground.caption
msgid "When application is in the &background"
msgstr "Wenn die Anwendung im Hintergrund läuft"

#: tfrmoptionsautorefresh.gbautorefreshdisable.caption
msgid "Disable auto-refresh"
msgstr "Kein automatisches Auffrischen"

#: tfrmoptionsautorefresh.gbautorefreshenable.caption
msgid "Refresh file list"
msgstr "Dateiliste auffrischen"

#: tfrmoptionsbehavior.cbalwaysshowtrayicon.caption
msgid "Al&ways show tray icon"
msgstr "Tray-Icon &immer anzeigen"

#: tfrmoptionsbehavior.cbblacklistunmounteddevices.caption
msgid "Automatically &hide unmounted devices"
msgstr "nicht mehr eingehängte Laufwerke automatisc&h ausblenden (Linux: unmounted)"

#: tfrmoptionsbehavior.cbminimizetotray.caption
msgctxt "TFRMOPTIONSBEHAVIOR.CBMINIMIZETOTRAY.CAPTION"
msgid "Mo&ve icon to system tray when minimized"
msgstr "In den System-Tray minimieren"

#: tfrmoptionsbehavior.cbonlyonce.caption
msgid "A&llow only one copy of DC at a time"
msgstr "Nur eine Instanz von Doub&le Commander gleichzeitig erlauben"

#: tfrmoptionsbehavior.edtdrivesblacklist.hint
msgid "Here you can enter one or more drives or mount points, separated by \";\"."
msgstr "Hier können ein oder mehrere Laufwerke oder Mount_Points angegeben werden, die so getrennt werden müssen \";\"."

#: tfrmoptionsbehavior.lbldrivesblacklist.caption
msgid "Drives &blacklist"
msgstr "A&usschlussliste für Laufwerke"

#: tfrmoptionsbriefview.gbcolumns.caption
msgid "Columns size"
msgstr "Spaltenweite"

#: tfrmoptionsbriefview.gbshowfileext.caption
msgid "Show file extensions"
msgstr "Zeige Dateiendungen"

#: tfrmoptionsbriefview.rbaligned.caption
msgid "ali&gned (with Tab)"
msgstr "Ausgerichtet (mit TAB)"

#: tfrmoptionsbriefview.rbdirectly.caption
msgid "di&rectly after filename"
msgstr "Unmittelba&r hinter dem Dateinamen"

#: tfrmoptionsbriefview.rbuseautosize.caption
msgid "Auto"
msgstr "Auto"

#: tfrmoptionsbriefview.rbusefixedcount.caption
msgid "Fixed columns count"
msgstr "Feste Anzahl von Spalten"

#: tfrmoptionsbriefview.rbusefixedwidth.caption
msgid "Fixed columns width"
msgstr "Feste Spaltenweite"

#: tfrmoptionscolumnsview.cbcuttexttocolwidth.caption
msgid "Cut &text to column width"
msgstr "&Text auf Spaltenbreite kürzen"

#: tfrmoptionscolumnsview.cbextendcellwidth.caption
msgid "&Extend cell width if text is not fitting into column"
msgstr ""

#: tfrmoptionscolumnsview.cbgridhorzline.caption
msgctxt "TFRMOPTIONSCOLUMNSVIEW.CBGRIDHORZLINE.CAPTION"
msgid "&Horizontal lines"
msgstr "&Horizontale Linien"

#: tfrmoptionscolumnsview.cbgridvertline.caption
msgctxt "TFRMOPTIONSCOLUMNSVIEW.CBGRIDVERTLINE.CAPTION"
msgid "&Vertical lines"
msgstr "&Vertikale Linien"

#: tfrmoptionscolumnsview.chkautofillcolumns.caption
msgctxt "TFRMOPTIONSCOLUMNSVIEW.CHKAUTOFILLCOLUMNS.CAPTION"
msgid "A&uto fill columns"
msgstr "Spalten &automatisch füllen"

#: tfrmoptionscolumnsview.gbshowgrid.caption
msgid "Show grid"
msgstr "Zeige Gitterstruktur zur Orientierung"

#: tfrmoptionscolumnsview.grpautosizecolumns.caption
msgid "Auto-size columns"
msgstr "Größe der Spalten automatisch einstellen"

#: tfrmoptionscolumnsview.lblautosizecolumn.caption
msgctxt "TFRMOPTIONSCOLUMNSVIEW.LBLAUTOSIZECOLUMN.CAPTION"
msgid "Auto si&ze column:"
msgstr "&Größe der Spalten automatisch einstellen:"

#: tfrmoptionsconfiguration.btnconfigapply.caption
msgctxt "TFRMOPTIONSCONFIGURATION.BTNCONFIGAPPLY.CAPTION"
msgid "A&pply"
msgstr "&Übernehmen"

#: tfrmoptionsconfiguration.btnconfigedit.caption
msgctxt "TFRMOPTIONSCONFIGURATION.BTNCONFIGEDIT.CAPTION"
msgid "&Edit"
msgstr "B&earbeiten"

#: tfrmoptionsconfiguration.cbcmdlinehistory.caption
msgctxt "TFRMOPTIONSCONFIGURATION.CBCMDLINEHISTORY.CAPTION"
msgid "Co&mmand line history"
msgstr "&Verlauf der Befehlszeile"

#: tfrmoptionsconfiguration.cbdirhistory.caption
msgctxt "TFRMOPTIONSCONFIGURATION.CBDIRHISTORY.CAPTION"
msgid "&Directory history"
msgstr "Ver&zeichnisverlauf"

#: tfrmoptionsconfiguration.cbfilemaskhistory.caption
msgctxt "TFRMOPTIONSCONFIGURATION.CBFILEMASKHISTORY.CAPTION"
msgid "&File mask history"
msgstr "Dateimasken-Verlau&f"

#: tfrmoptionsconfiguration.chksaveconfiguration.caption
msgctxt "TFRMOPTIONSCONFIGURATION.CHKSAVECONFIGURATION.CAPTION"
msgid "Sa&ve configuration"
msgstr "&Konfiguration speichern"

#: tfrmoptionsconfiguration.chksearchreplacehistory.caption
msgctxt "TFRMOPTIONSCONFIGURATION.CHKSEARCHREPLACEHISTORY.CAPTION"
msgid "Searc&h/Replace history"
msgstr "Suc&he / Ersetze Verlauf"

#: tfrmoptionsconfiguration.gbdirectories.caption
msgctxt "tfrmoptionsconfiguration.gbdirectories.caption"
msgid "Directories"
msgstr "Verzeichnisse"

#: tfrmoptionsconfiguration.gblocconfigfiles.caption
msgid "Location of configuration files"
msgstr "Speicherort der Konfigurationsdatei"

#: tfrmoptionsconfiguration.gbsaveonexit.caption
msgid "Save on exit"
msgstr "Beim Beenden speichern"

#: tfrmoptionsconfiguration.gbsortorderconfigurationoption.caption
msgid "Sort order of configuration order in left tree"
msgstr "Reihenfolge der Konfigurationsfolge im linken Baum sortieren"

#: tfrmoptionsconfiguration.lblcmdlineconfigdir.caption
msgid "Set on command line"
msgstr "An Eingabeaufforderung übergeben"

#: tfrmoptionsconfiguration.lbliconthemes.caption
msgid "Icon themes:"
msgstr ""

#: tfrmoptionsconfiguration.lblthumbcache.caption
msgid "Thumbnails cache:"
msgstr ""

#: tfrmoptionsconfiguration.rbprogramdir.caption
msgid "P&rogram directory (portable version)"
msgstr "P&rogrammverzeichnis (portable Version)"

#: tfrmoptionsconfiguration.rbuserhomedir.caption
msgid "&User home directory"
msgstr "&Benutzerverzeichnis"

#: tfrmoptionscustomcolumns.btnallallowovercolor.caption
msgctxt "tfrmoptionscustomcolumns.btnallallowovercolor.caption"
msgid "All"
msgstr "Alle"

#: tfrmoptionscustomcolumns.btnallallowovercolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallallowovercolor.hint"
msgid "Apply modification to all columns"
msgstr "Änderung für alle Spalten übernehmen"

#: tfrmoptionscustomcolumns.btnallbackcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor.caption"
msgid "All"
msgstr "Alle"

#: tfrmoptionscustomcolumns.btnallbackcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor.hint"
msgid "Apply modification to all columns"
msgstr "Änderung für alle Spalten übernehmen"

#: tfrmoptionscustomcolumns.btnallbackcolor2.caption
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor2.caption"
msgid "All"
msgstr "Alle"

#: tfrmoptionscustomcolumns.btnallbackcolor2.hint
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor2.hint"
msgid "Apply modification to all columns"
msgstr "Änderung für alle Spalten übernehmen"

#: tfrmoptionscustomcolumns.btnallcursorcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnallcursorcolor.caption"
msgid "All"
msgstr "Alle"

#: tfrmoptionscustomcolumns.btnallcursorcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallcursorcolor.hint"
msgid "Apply modification to all columns"
msgstr "Änderung für alle Spalten übernehmen"

#: tfrmoptionscustomcolumns.btnallcursortext.caption
msgctxt "tfrmoptionscustomcolumns.btnallcursortext.caption"
msgid "All"
msgstr "Alle"

#: tfrmoptionscustomcolumns.btnallcursortext.hint
msgctxt "tfrmoptionscustomcolumns.btnallcursortext.hint"
msgid "Apply modification to all columns"
msgstr "Änderung für alle Spalten übernehmen"

#: tfrmoptionscustomcolumns.btnallfont.caption
msgctxt "tfrmoptionscustomcolumns.btnallfont.caption"
msgid "All"
msgstr "Alle"

#: tfrmoptionscustomcolumns.btnallfont.hint
msgctxt "tfrmoptionscustomcolumns.btnallfont.hint"
msgid "Apply modification to all columns"
msgstr "Änderung für alle Spalten übernehmen"

#: tfrmoptionscustomcolumns.btnallforecolor.caption
msgctxt "tfrmoptionscustomcolumns.btnallforecolor.caption"
msgid "All"
msgstr "Alle"

#: tfrmoptionscustomcolumns.btnallforecolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallforecolor.hint"
msgid "Apply modification to all columns"
msgstr "Änderung für alle Spalten übernehmen"

#: tfrmoptionscustomcolumns.btnallinactivecursorcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnallinactivecursorcolor.caption"
msgid "All"
msgstr "Alle"

#: tfrmoptionscustomcolumns.btnallinactivecursorcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallinactivecursorcolor.hint"
msgid "Apply modification to all columns"
msgstr "Änderung für alle Spalten übernehmen"

#: tfrmoptionscustomcolumns.btnallinactivemarkcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnallinactivemarkcolor.caption"
msgid "All"
msgstr "Alle"

#: tfrmoptionscustomcolumns.btnallinactivemarkcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallinactivemarkcolor.hint"
msgid "Apply modification to all columns"
msgstr "Änderung für alle Spalten übernehmen"

#: tfrmoptionscustomcolumns.btnallmarkcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnallmarkcolor.caption"
msgid "All"
msgstr "Alle"

#: tfrmoptionscustomcolumns.btnallmarkcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnallmarkcolor.hint"
msgid "Apply modification to all columns"
msgstr "Änderung für alle Spalten übernehmen"

#: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnalluseinactiveselcolor.caption"
msgid "All"
msgstr "Alle"

#: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnalluseinactiveselcolor.hint"
msgid "Apply modification to all columns"
msgstr "Änderung für alle Spalten übernehmen"

#: tfrmoptionscustomcolumns.btnalluseinvertedselection.caption
msgctxt "tfrmoptionscustomcolumns.btnalluseinvertedselection.caption"
msgid "All"
msgstr "Alle"

#: tfrmoptionscustomcolumns.btnalluseinvertedselection.hint
msgctxt "tfrmoptionscustomcolumns.btnalluseinvertedselection.hint"
msgid "Apply modification to all columns"
msgstr "Änderung für alle Spalten übernehmen"

#: tfrmoptionscustomcolumns.btnbackcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnbackcolor.caption"
msgid ">>"
msgstr ">>"

#: tfrmoptionscustomcolumns.btnbackcolor2.caption
msgctxt "tfrmoptionscustomcolumns.btnbackcolor2.caption"
msgid ">>"
msgstr ">>"

#: tfrmoptionscustomcolumns.btncursorbordercolor.caption
msgctxt "tfrmoptionscustomcolumns.btncursorbordercolor.caption"
msgid ">>"
msgstr ">>"

#: tfrmoptionscustomcolumns.btncursorcolor.caption
msgctxt "tfrmoptionscustomcolumns.btncursorcolor.caption"
msgid ">>"
msgstr ">>"

#: tfrmoptionscustomcolumns.btncursortext.caption
msgctxt "tfrmoptionscustomcolumns.btncursortext.caption"
msgid ">>"
msgstr ">>"

#: tfrmoptionscustomcolumns.btndeleteconfigcolumns.caption
msgctxt "tfrmoptionscustomcolumns.btndeleteconfigcolumns.caption"
msgid "&Delete"
msgstr "L&öschen"

#: tfrmoptionscustomcolumns.btnfont.caption
msgctxt "tfrmoptionscustomcolumns.btnfont.caption"
msgid "..."
msgstr "..."

#: tfrmoptionscustomcolumns.btnforecolor.caption
msgctxt "tfrmoptionscustomcolumns.btnforecolor.caption"
msgid ">>"
msgstr ">>"

#: tfrmoptionscustomcolumns.btngotosetdefault.caption
msgid "Go to set default"
msgstr "Standard für Gehe zu"

#: tfrmoptionscustomcolumns.btngotosetdefault.hint
msgctxt "tfrmoptionscustomcolumns.btngotosetdefault.hint"
msgid "Reset to default"
msgstr "Auf Standard zurücksetzen"

#: tfrmoptionscustomcolumns.btninactivecursorcolor.caption
msgctxt "tfrmoptionscustomcolumns.btninactivecursorcolor.caption"
msgid ">>"
msgstr ">>"

#: tfrmoptionscustomcolumns.btninactivemarkcolor.caption
msgctxt "tfrmoptionscustomcolumns.btninactivemarkcolor.caption"
msgid ">>"
msgstr ">>"

#: tfrmoptionscustomcolumns.btnmarkcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnmarkcolor.caption"
msgid ">>"
msgstr ">>"

#: tfrmoptionscustomcolumns.btnnewconfig.caption
msgctxt "tfrmoptionscustomcolumns.btnnewconfig.caption"
msgid "New"
msgstr "Neu"

#: tfrmoptionscustomcolumns.btnnext.caption
msgid "Next"
msgstr "Nächstes"

#: tfrmoptionscustomcolumns.btnprev.caption
msgid "Previous"
msgstr "Vorheriges"

#: tfrmoptionscustomcolumns.btnrenameconfigcolumns.caption
msgctxt "tfrmoptionscustomcolumns.btnrenameconfigcolumns.caption"
msgid "Rename"
msgstr "Umbenennen"

#: tfrmoptionscustomcolumns.btnresetallowovercolor.caption
msgctxt "tfrmoptionscustomcolumns.btnresetallowovercolor.caption"
msgid "R"
msgstr "R"

#: tfrmoptionscustomcolumns.btnresetallowovercolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetallowovercolor.hint"
msgid "Reset to default"
msgstr "Auf Standard zurücksetzen"

#: tfrmoptionscustomcolumns.btnresetbackcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor.caption"
msgid "R"
msgstr "R"

#: tfrmoptionscustomcolumns.btnresetbackcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor.hint"
msgid "Reset to default"
msgstr "Auf Standard zurücksetzen"

#: tfrmoptionscustomcolumns.btnresetbackcolor2.caption
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor2.caption"
msgid "R"
msgstr "R"

#: tfrmoptionscustomcolumns.btnresetbackcolor2.hint
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor2.hint"
msgid "Reset to default"
msgstr "Auf Standard zurücksetzen"

#: tfrmoptionscustomcolumns.btnresetcursorborder.caption
msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.caption"
msgid "R"
msgstr "R"

#: tfrmoptionscustomcolumns.btnresetcursorborder.hint
msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.hint"
msgid "Reset to default"
msgstr "Auf Standard zurücksetzen"

#: tfrmoptionscustomcolumns.btnresetcursorcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnresetcursorcolor.caption"
msgid "R"
msgstr "R"

#: tfrmoptionscustomcolumns.btnresetcursorcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetcursorcolor.hint"
msgid "Reset to default"
msgstr "Auf Standard zurücksetzen"

#: tfrmoptionscustomcolumns.btnresetcursortext.caption
msgctxt "tfrmoptionscustomcolumns.btnresetcursortext.caption"
msgid "R"
msgstr "R"

#: tfrmoptionscustomcolumns.btnresetcursortext.hint
msgctxt "tfrmoptionscustomcolumns.btnresetcursortext.hint"
msgid "Reset to default"
msgstr "Auf Standard zurücksetzen"

#: tfrmoptionscustomcolumns.btnresetfont.caption
msgctxt "tfrmoptionscustomcolumns.btnresetfont.caption"
msgid "R"
msgstr "R"

#: tfrmoptionscustomcolumns.btnresetfont.hint
msgctxt "tfrmoptionscustomcolumns.btnresetfont.hint"
msgid "Reset to default"
msgstr "Auf Standard zurücksetzen"

#: tfrmoptionscustomcolumns.btnresetforecolor.caption
msgctxt "tfrmoptionscustomcolumns.btnresetforecolor.caption"
msgid "R"
msgstr "R"

#: tfrmoptionscustomcolumns.btnresetforecolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetforecolor.hint"
msgid "Reset to default"
msgstr "Auf Standard zurücksetzen"

#: tfrmoptionscustomcolumns.btnresetframecursor.caption
msgctxt "tfrmoptionscustomcolumns.btnresetframecursor.caption"
msgid "R"
msgstr "R"

#: tfrmoptionscustomcolumns.btnresetframecursor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetframecursor.hint"
msgid "Reset to default"
msgstr "Auf Standard zurücksetzen"

#: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnresetinactivecursorcolor.caption"
msgid "R"
msgstr "R"

#: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetinactivecursorcolor.hint"
msgid "Reset to default"
msgstr "Auf Standard zurücksetzen"

#: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnresetinactivemarkcolor.caption"
msgid "R"
msgstr "R"

#: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetinactivemarkcolor.hint"
msgid "Reset to default"
msgstr "Auf Standard zurücksetzen"

#: tfrmoptionscustomcolumns.btnresetmarkcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnresetmarkcolor.caption"
msgid "R"
msgstr "R"

#: tfrmoptionscustomcolumns.btnresetmarkcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetmarkcolor.hint"
msgid "Reset to default"
msgstr "Auf Standard zurücksetzen"

#: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.caption
msgctxt "tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.caption"
msgid "R"
msgstr "R"

#: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.hint
msgctxt "tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.hint"
msgid "Reset to default"
msgstr "Auf Standard zurücksetzen"

#: tfrmoptionscustomcolumns.btnresetuseinvertedselection.caption
msgctxt "tfrmoptionscustomcolumns.btnresetuseinvertedselection.caption"
msgid "R"
msgstr "R"

#: tfrmoptionscustomcolumns.btnresetuseinvertedselection.hint
msgctxt "tfrmoptionscustomcolumns.btnresetuseinvertedselection.hint"
msgid "Reset to default"
msgstr "Auf Standard zurücksetzen"

#: tfrmoptionscustomcolumns.btnsaveasconfigcolumns.caption
msgctxt "tfrmoptionscustomcolumns.btnsaveasconfigcolumns.caption"
msgid "Save as"
msgstr "Speichern unter..."

#: tfrmoptionscustomcolumns.btnsaveconfigcolumns.caption
msgctxt "tfrmoptionscustomcolumns.btnsaveconfigcolumns.caption"
msgid "Save"
msgstr "Speichern"

#: tfrmoptionscustomcolumns.cballowovercolor.caption
msgctxt "tfrmoptionscustomcolumns.cballowovercolor.caption"
msgid "Allow Overcolor"
msgstr "Erlaube Farb-Überschneidung"

#: tfrmoptionscustomcolumns.cbapplychangeforallcolumns.caption
msgid "When clicking to change something, change for all columns"
msgstr "Wenn etwas geändert wird, das in allen Spalten ändern"

#: tfrmoptionscustomcolumns.cbconfigcolumns.text
msgctxt "tfrmoptionscustomcolumns.cbconfigcolumns.text"
msgid "General"
msgstr "Allgemein"

#: tfrmoptionscustomcolumns.cbcursorborder.caption
msgctxt "tfrmoptionscustomcolumns.cbcursorborder.caption"
msgid "Cursor border"
msgstr "Cursor Begrenzung"

#: tfrmoptionscustomcolumns.cbuseframecursor.caption
msgid "Use Frame Cursor"
msgstr "Nutze Frame-Cursor"

#: tfrmoptionscustomcolumns.cbuseinactiveselcolor.caption
msgid "Use Inactive Selection Color"
msgstr "Farbe der inaktiven Auswahl nutzen"

#: tfrmoptionscustomcolumns.cbuseinvertedselection.caption
msgid "Use Inverted Selection"
msgstr "Umgekehrte Auswahl nutzen"

#: tfrmoptionscustomcolumns.chkusecustomview.caption
msgid "Use custom font and color for this view"
msgstr "Angepasste Schriftart und -farbe für diese Ansicht nutzen"

#: tfrmoptionscustomcolumns.lblbackcolor.caption
msgctxt "tfrmoptionscustomcolumns.lblbackcolor.caption"
msgid "BackGround:"
msgstr "Hintergrund:"

#: tfrmoptionscustomcolumns.lblbackcolor2.caption
msgctxt "tfrmoptionscustomcolumns.lblbackcolor2.caption"
msgid "Background 2:"
msgstr "Hintergrund 2:"

#: tfrmoptionscustomcolumns.lblconfigcolumns.caption
msgid "Con&figure columns view:"
msgstr "Spaltenansicht konfigurieren:"

#: tfrmoptionscustomcolumns.lblcurrentcolumn.caption
msgid "[Current Column Name]"
msgstr "[Aktuelle Bezeichnung der Spalte]"

#: tfrmoptionscustomcolumns.lblcursorcolor.caption
msgctxt "tfrmoptionscustomcolumns.lblcursorcolor.caption"
msgid "Cursor Color:"
msgstr "Cursorfarbe"

#: tfrmoptionscustomcolumns.lblcursortext.caption
msgctxt "tfrmoptionscustomcolumns.lblcursortext.caption"
msgid "Cursor Text:"
msgstr "Cursortext"

#: tfrmoptionscustomcolumns.lblfontname.caption
msgctxt "tfrmoptionscustomcolumns.lblfontname.caption"
msgid "Font:"
msgstr "Schriftart:"

#: tfrmoptionscustomcolumns.lblfontsize.caption
msgctxt "tfrmoptionscustomcolumns.lblfontsize.caption"
msgid "Size:"
msgstr "Größe:"

#: tfrmoptionscustomcolumns.lblforecolor.caption
msgctxt "tfrmoptionscustomcolumns.lblforecolor.caption"
msgid "Text Color:"
msgstr "Textfarbe"

#: tfrmoptionscustomcolumns.lblinactivecursorcolor.caption
msgctxt "tfrmoptionscustomcolumns.lblinactivecursorcolor.caption"
msgid "Inactive Cursor Color:"
msgstr "Farbe für inaktiven Cursor:"

#: tfrmoptionscustomcolumns.lblinactivemarkcolor.caption
msgctxt "tfrmoptionscustomcolumns.lblinactivemarkcolor.caption"
msgid "Inactive Mark Color:"
msgstr "Farbe für inaktive Markierung:"

#: tfrmoptionscustomcolumns.lblmarkcolor.caption
msgctxt "tfrmoptionscustomcolumns.lblmarkcolor.caption"
msgid "Mark Color:"
msgstr "Markierungsfarbe"

#: tfrmoptionscustomcolumns.lblpreviewtop.caption
msgctxt "tfrmoptionscustomcolumns.lblpreviewtop.caption"
msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings."
msgstr "Unten ist eine Vorschau. Sie kann für eine sofortige Überprüfung er Einstellungen genutzt werden."

#: tfrmoptionscustomcolumns.lblworkingcolumn.caption
msgid "Settings for column:"
msgstr "Einstellungen für Spalten:"

#: tfrmoptionscustomcolumns.miaddcolumn.caption
msgctxt "tfrmoptionscustomcolumns.miaddcolumn.caption"
msgid "Add column"
msgstr "Spalte hinzufügen"

#: tfrmoptionsdiffer.rgresultingframepositionaftercompare.caption
msgid "Position of frame panel after the comparison:"
msgstr "Position des Frame-Panel nach dem Vergleich:"

#: tfrmoptionsdirectoryhotlist.actaddactiveframedir.caption
msgid "Add directory of the &active frame"
msgstr ""

#: tfrmoptionsdirectoryhotlist.actaddbothframedir.caption
msgid "Add &directories of the active && inactive frames"
msgstr ""

#: tfrmoptionsdirectoryhotlist.actaddbrowseddir.caption
msgid "Add directory I will bro&wse to"
msgstr ""

#: tfrmoptionsdirectoryhotlist.actaddcopyofentry.caption
msgid "Add a copy of the selected entry"
msgstr "Füge eine Kopie des gewählten Eintrages hinzu"

#: tfrmoptionsdirectoryhotlist.actaddselectionsfromframe.caption
msgid "Add current &selected or active directories of active frame"
msgstr ""

#: tfrmoptionsdirectoryhotlist.actaddseparator.caption
msgctxt "tfrmoptionsdirectoryhotlist.actaddseparator.caption"
msgid "Add a separator"
msgstr "Füge ein Trennzeichen hinzu"

#: tfrmoptionsdirectoryhotlist.actaddsubmenu.caption
msgid "Add a sub menu"
msgstr ""

#: tfrmoptionsdirectoryhotlist.actaddtypeddir.caption
msgctxt "tfrmoptionsdirectoryhotlist.actaddtypeddir.caption"
msgid "Add directory I will type"
msgstr "Füge Verzeichnis hinzu, dass ich eintippe"

#: tfrmoptionsdirectoryhotlist.actcollapseall.caption
msgctxt "tfrmoptionsdirectoryhotlist.actcollapseall.caption"
msgid "Collapse all"
msgstr "Alle zusammenfalten"

#: tfrmoptionsdirectoryhotlist.actcollapseitem.caption
msgid "Collapse item"
msgstr ""

#: tfrmoptionsdirectoryhotlist.actcut.caption
msgid "Cut selection of entries"
msgstr ""

#: tfrmoptionsdirectoryhotlist.actdeleteall.caption
msgid "Delete all!"
msgstr ""

#: tfrmoptionsdirectoryhotlist.actdeleteselecteditem.caption
#, fuzzy
msgctxt "tfrmoptionsdirectoryhotlist.actdeleteselecteditem.caption"
msgid "Delete selected item"
msgstr "Lösche gewählte Einträge"

#: tfrmoptionsdirectoryhotlist.actdeletesubmenuandelem.caption
msgid "Delete sub-menu and all its elements"
msgstr ""

#: tfrmoptionsdirectoryhotlist.actdeletesubmenukeepelem.caption
msgid "Delete just sub-menu but keep elements"
msgstr ""

#: tfrmoptionsdirectoryhotlist.actexpanditem.caption
msgid "Expand item"
msgstr ""

#: tfrmoptionsdirectoryhotlist.actfocustreewindow.caption
msgid "Focus tree window"
msgstr ""

#: tfrmoptionsdirectoryhotlist.actgotofirstitem.caption
msgid "Goto first item"
msgstr ""

#: tfrmoptionsdirectoryhotlist.actgotolastitem.caption
msgid "Goto last item"
msgstr ""

#: tfrmoptionsdirectoryhotlist.actgotonextitem.caption
msgid "Go to next item"
msgstr ""

#: tfrmoptionsdirectoryhotlist.actgotopreviousitem.caption
msgid "Go to previous item"
msgstr ""

#: tfrmoptionsdirectoryhotlist.actinsertactiveframedir.caption
msgid "Insert directory of the &active frame"
msgstr ""

#: tfrmoptionsdirectoryhotlist.actinsertbothframedir.caption
msgid "Insert &directories of the active && inactive frames"
msgstr ""

#: tfrmoptionsdirectoryhotlist.actinsertbrowseddir.caption
msgid "Insert directory I will bro&wse to"
msgstr ""

#: tfrmoptionsdirectoryhotlist.actinsertcopyofentry.caption
msgid "Insert a copy of the selected entry"
msgstr ""

#: tfrmoptionsdirectoryhotlist.actinsertselectionsfromframe.caption
msgid "Insert current &selected or active directories of active frame"
msgstr ""

#: tfrmoptionsdirectoryhotlist.actinsertseparator.caption
msgid "Insert a separator"
msgstr ""

#: tfrmoptionsdirectoryhotlist.actinsertsubmenu.caption
msgid "Insert sub menu"
msgstr ""

#: tfrmoptionsdirectoryhotlist.actinserttypeddir.caption
#, fuzzy
msgctxt "tfrmoptionsdirectoryhotlist.actinserttypeddir.caption"
msgid "Insert directory I will type"
msgstr "Füge Verzeichnis ein, das ich eintippe"

#: tfrmoptionsdirectoryhotlist.actmovetonext.caption
msgid "Move to next"
msgstr ""

#: tfrmoptionsdirectoryhotlist.actmovetoprevious.caption
msgid "Move to previous"
msgstr ""

#: tfrmoptionsdirectoryhotlist.actopenallbranches.caption
#, fuzzy
msgctxt "tfrmoptionsdirectoryhotlist.actopenallbranches.caption"
msgid "Open all branches"
msgstr "Alle Zweige öffnen"

#: tfrmoptionsdirectoryhotlist.actpaste.caption
msgid "Paste what was cut"
msgstr ""

#: tfrmoptionsdirectoryhotlist.actsearchandreplaceinpath.caption
msgid "Search && replace in &path"
msgstr ""

#: tfrmoptionsdirectoryhotlist.actsearchandreplaceinpathandtarget.caption
msgid "Search && replace in both path and target"
msgstr ""

#: tfrmoptionsdirectoryhotlist.actsearchandreplaceintargetpath.caption
msgid "Search && replace in &target path"
msgstr ""

#: tfrmoptionsdirectoryhotlist.acttweakpath.caption
msgid "Tweak path"
msgstr ""

#: tfrmoptionsdirectoryhotlist.acttweaktargetpath.caption
msgid "Tweak target path"
msgstr ""

#: tfrmoptionsdirectoryhotlist.btnadd.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnadd.caption"
msgid "A&dd..."
msgstr "Füge hinzu..."

#: tfrmoptionsdirectoryhotlist.btnbackup.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnbackup.caption"
msgid "Bac&kup..."
msgstr "Backup..."

#: tfrmoptionsdirectoryhotlist.btndelete.caption
msgctxt "tfrmoptionsdirectoryhotlist.btndelete.caption"
msgid "De&lete..."
msgstr "Lösche..."

#: tfrmoptionsdirectoryhotlist.btnexport.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnexport.caption"
msgid "E&xport..."
msgstr "Exportieren..."

#: tfrmoptionsdirectoryhotlist.btnhelp.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnhelp.caption"
msgid "&Help"
msgstr "Hilfe"

#: tfrmoptionsdirectoryhotlist.btnimport.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnimport.caption"
msgid "Impo&rt..."
msgstr "Importieren..."

#: tfrmoptionsdirectoryhotlist.btninsert.caption
msgctxt "tfrmoptionsdirectoryhotlist.btninsert.caption"
msgid "&Insert..."
msgstr "Einfügen..."

#: tfrmoptionsdirectoryhotlist.btnmiscellaneous.caption
msgid "&Miscellaneous..."
msgstr "Verschiedenes..."

#: tfrmoptionsdirectoryhotlist.btnrelativepath.hint
msgctxt "tfrmoptionsdirectoryhotlist.btnrelativepath.hint"
msgid "Some functions to select appropriate path"
msgstr "Einige Funktionen um angemessene Pfade zu wählen"

#: tfrmoptionsdirectoryhotlist.btnrelativetarget.hint
msgctxt "tfrmoptionsdirectoryhotlist.btnrelativetarget.hint"
msgid "Some functions to select appropriate target"
msgstr "Einige Funktionen um angemessene Ziele zu wählen"

#: tfrmoptionsdirectoryhotlist.btnsort.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnsort.caption"
msgid "&Sort..."
msgstr "Sortieren..."

#: tfrmoptionsdirectoryhotlist.cbaddtarget.caption
msgid "&When adding directory, add also target"
msgstr "Beim Hinzufügen eines Verzeichnisses, auch das Ziel hinzufügen"

#: tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption
msgctxt "tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption"
msgid "Alwa&ys expand tree"
msgstr "Struktur immer aufklappen"

#: tfrmoptionsdirectoryhotlist.cbshowonlyvalidenv.caption
msgid "Show only &valid environment variables"
msgstr "Nur gültige Umgebungsvariablen anzeigen"

#: tfrmoptionsdirectoryhotlist.cbshowpathinpopup.caption
msgid "In pop&up, show [path also]"
msgstr "Im Pop-Up-Menü [auch Pfad] zeigen"

#: tfrmoptionsdirectoryhotlist.cbsorthotdirpath.text
msgctxt "tfrmoptionsdirectoryhotlist.cbsorthotdirpath.text"
msgid "Name, a-z"
msgstr "Name, a bis z"

#: tfrmoptionsdirectoryhotlist.cbsorthotdirtarget.text
msgctxt "tfrmoptionsdirectoryhotlist.cbsorthotdirtarget.text"
msgid "Name, a-z"
msgstr "Name, a bis z"

#: tfrmoptionsdirectoryhotlist.gbdirectoryhotlist.caption
msgid "Directory Hotlist (reorder by drag && drop)"
msgstr "Hotlist Verzeichnisse (umsortieren durch Drag && Drop)"

#: tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption
msgctxt "tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption"
msgid "Other options"
msgstr "Andere Optionen"

#: tfrmoptionsdirectoryhotlist.lbledithotdirname.editlabel.caption
msgctxt "tfrmoptionsdirectoryhotlist.lbledithotdirname.editlabel.caption"
msgid "Name:"
msgstr "Name:"

#: tfrmoptionsdirectoryhotlist.lbledithotdirpath.editlabel.caption
msgctxt "tfrmoptionsdirectoryhotlist.lbledithotdirpath.editlabel.caption"
msgid "Path:"
msgstr "Pfad:"

#: tfrmoptionsdirectoryhotlist.lbledithotdirtarget.editlabel.caption
msgctxt "tfrmoptionsdirectoryhotlist.lbledithotdirtarget.editlabel.caption"
msgid "&Target:"
msgstr "Ziel:"

#: tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption
msgctxt "tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption"
msgid "...current le&vel of item(s) selected only"
msgstr "...aktuelles Level an markierten Einträgen"

#: tfrmoptionsdirectoryhotlist.midetectifpathexist.caption
msgctxt "tfrmoptionsdirectoryhotlist.midetectifpathexist.caption"
msgid "Scan all &hotdir's path to validate the ones that actually exist"
msgstr "Alle Hot-Dir Verzeichnisse scannen um die zu erkennen, die wirklich existieren"

#: tfrmoptionsdirectoryhotlist.midetectifpathtargetexist.caption
msgctxt "tfrmoptionsdirectoryhotlist.midetectifpathtargetexist.caption"
msgid "&Scan all hotdir's path && target to validate the ones that actually exist"
msgstr "Alle Hot-Dir Verzeichnisse und Ziele scannen, um die zu erkennen, die wirklich existieren"

#: tfrmoptionsdirectoryhotlist.miexporttohotlistfile.caption
msgid "to a Directory &Hotlist file (.hotlist)"
msgstr "zu einer Verzeichnis-Hotlist (.hotlist)"

#: tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption
msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption"
msgid "to a \"wincmd.ini\" of TC (&keep existing)"
msgstr "zu einer \"wincmd.ini\" aus TotalCommander (bestehende erhalten)"

#: tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption
msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption"
msgid "to a \"wincmd.ini\" of TC (&erase existing)"
msgstr "zu einer \"wincmd.ini\" aus TotalCommander (bestehende ersetzen)"

#: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption
msgctxt "tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption"
msgid "Go to &configure TC related info"
msgstr "Starte die Konfiguration von TC-bezogenen Informationen"

#: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo2.caption
msgctxt "tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo2.caption"
msgid "Go to &configure TC related info"
msgstr "Starte die Konfiguration von TC-bezogenen Informationen"

#: tfrmoptionsdirectoryhotlist.mihotdirtestmenu.caption
msgid "HotDirTestMenu"
msgstr "HotDir-Testmenü"

#: tfrmoptionsdirectoryhotlist.miimportfromhotlistfile.caption
msgid "from a Directory &Hotlist file (.hotlist)"
msgstr "aus einer Verzeichnis-Hotlist (.hotlis)"

#: tfrmoptionsdirectoryhotlist.miimporttotalcommander.caption
msgid "from \"&wincmd.ini\" of TC"
msgstr "aus einer \"wincmd.ini\" des TotalCommander"

#: tfrmoptionsdirectoryhotlist.minavigate.caption
msgid "&Navigate..."
msgstr ""

#: tfrmoptionsdirectoryhotlist.mirestorebackuphotlist.caption
msgid "&Restore a backup of Directory Hotlist"
msgstr "Wiederherstellen einer Verzeichnis-Hotlist aus einem Backup"

#: tfrmoptionsdirectoryhotlist.misavebackuphotlist.caption
msgid "&Save a backup of current Directory Hotlist"
msgstr "Speichern einer aktuellen Verzeichnis-Hotlist in ein Backup"

#: tfrmoptionsdirectoryhotlist.misearchandreplace.caption
msgctxt "tfrmoptionsdirectoryhotlist.misearchandreplace.caption"
msgid "Search and &replace..."
msgstr "Suchen und Ersetzen..."

#: tfrmoptionsdirectoryhotlist.misorteverything.caption
msgctxt "tfrmoptionsdirectoryhotlist.misorteverything.caption"
msgid "...everything, from A to &Z!"
msgstr "...alles von A bis Z"

#: tfrmoptionsdirectoryhotlist.misortsinglegroup.caption
msgctxt "tfrmoptionsdirectoryhotlist.misortsinglegroup.caption"
msgid "...single &group of item(s) only"
msgstr "...nur einzelne Gruppe von Einträgen"

#: tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption
msgctxt "tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption"
msgid "...&content of submenu(s) selected, no sublevel"
msgstr "...Inhalt von Untermenüs gewählt, aber keine tieferen Level"

#: tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption
msgctxt "tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption"
msgid "...content of submenu(s) selected and &all sublevels"
msgstr "Inhalt von Untermenüs ausgewählt, auch alle tiferen Level"

#: tfrmoptionsdirectoryhotlist.mitestresultinghotlistmenu.caption
msgctxt "tfrmoptionsdirectoryhotlist.mitestresultinghotlistmenu.caption"
msgid "Test resultin&g menu"
msgstr "Menü aus Testergebnissen"

#: tfrmoptionsdirectoryhotlist.mitweakpath.caption
msgid "Tweak &path"
msgstr ""

#: tfrmoptionsdirectoryhotlist.mitweaktargetpath.caption
msgid "Tweak &target path"
msgstr ""

#: tfrmoptionsdirectoryhotlist.rgwheretoadd.caption
msgid "Addition from main panel"
msgstr "Zusatz aus dem Hauptpanel:"

#: tfrmoptionsdragdrop.cbdraganddropaskformateachtime.caption
msgid "From all the supported formats, ask which one to use every time"
msgstr "Frage welches von allen unterstützten Formaten ständig benutzt werden soll"

#: tfrmoptionsdragdrop.cbdraganddropsaveunicodetextinuft8.caption
msgid "When saving Unicode text, save it in UTF8 format (will be UTF16 otherwise)"
msgstr "Wenn Unicode-Text gespeichert werden soll, nutze das UTF-8 Format (ansonsten wird das UTF-16 Format benutzt)"

#: tfrmoptionsdragdrop.cbdraganddroptextautofilename.caption
msgid "When dropping text, generate filename automatically (otherwise will prompt the user)"
msgstr "Wenn Text fallen gelassen wird, erstelle den Dateinamen automatisch (ansonsten wird der Nutzer gefragt)"

#: tfrmoptionsdragdrop.cbshowconfirmationdialog.caption
msgid "&Show confirmation dialog after drop"
msgstr "Zeige Be&stätigungsdialog nach dem Ziehen und Ablegen von Dateien"

#: tfrmoptionsdragdrop.gbtextdraganddroprelatedoptions.caption
msgid "When drag && dropping text into panels:"
msgstr "Wenn Drag && Drop benutzt wird:"

#: tfrmoptionsdragdrop.lblmostdesiredtextformat1.caption
msgid "Place the most desired format on top of list (use dag && drop):"
msgstr "Das wahrscheinlichste Format an oberste Stelle setzen (Nutze Drag && Drop):"

#: tfrmoptionsdragdrop.lblmostdesiredtextformat2.caption
msgid "(if the most desired is not present, we'll take second one and so on)"
msgstr "(ist das wahrscheinlichste Format nicht verfügbar, nächstes verwenden, und so weiter)"

#: tfrmoptionsdragdrop.lblwarningforaskformat.caption
msgid "(will not work with some source application, so try to uncheck if problem)"
msgstr "(wird mit einigen Quellen nicht fünktionieren, bitte in diesem Fall versuchen das Problem durch Nicht-Markieren zu lösen)"

#: tfrmoptionsdriveslistbutton.cbshowfilesystem.caption
msgid "Show &file system"
msgstr "&Zeige Dateisystem"

#: tfrmoptionsdriveslistbutton.cbshowfreespace.caption
msgid "Show fr&ee space"
msgstr "Z&eige freien Speicherplatz"

#: tfrmoptionsdriveslistbutton.cbshowlabel.caption
msgid "Show &label"
msgstr "Zeige &Laufwerksbezeichnung"

#: tfrmoptionsdriveslistbutton.gbdriveslist.caption
msgid "Drives list"
msgstr "Laufwerksliste"

#: tfrmoptionseditor.chkscrollpastendline.caption
msgid "Caret past end of line"
msgstr "Cursor über Zeilenende hinaus"

#: tfrmoptionseditor.chkshowspecialchars.caption
msgid "Show special characters"
msgstr "Sonderzeichen anzeigen"

#: tfrmoptionseditor.gbinternaleditor.caption
msgid "Internal editor options"
msgstr "Optionen des internen Editors"

#: tfrmoptionseditorcolors.backgroundlabel.caption
msgctxt "tfrmoptionseditorcolors.backgroundlabel.caption"
msgid "Bac&kground"
msgstr "&Hintergrund"

#: tfrmoptionseditorcolors.backgroundusedefaultcheckbox.caption
msgctxt "tfrmoptionseditorcolors.backgroundusedefaultcheckbox.caption"
msgid "Bac&kground"
msgstr "&Hintergrund"

#: tfrmoptionseditorcolors.btnresetmask.hint
msgid "Reset"
msgstr "Zurücksetzen"

#: tfrmoptionseditorcolors.btnsavemask.hint
msgctxt "tfrmoptionseditorcolors.btnsavemask.hint"
msgid "Save"
msgstr "Speichern"

#: tfrmoptionseditorcolors.bvlattributesection.caption
msgid "Element Attributes"
msgstr "Attribut des Elements"

#: tfrmoptionseditorcolors.foregroundlabel.caption
msgctxt "tfrmoptionseditorcolors.foregroundlabel.caption"
msgid "Fo&reground"
msgstr "Vo&rdergrund"

#: tfrmoptionseditorcolors.foregroundusedefaultcheckbox.caption
msgctxt "tfrmoptionseditorcolors.foregroundusedefaultcheckbox.caption"
msgid "Fo&reground"
msgstr "Vo&rdergrund"

#: tfrmoptionseditorcolors.framecolorusedefaultcheckbox.caption
msgid "&Text-mark"
msgstr "&Textmarkierung"

#: tfrmoptionseditorcolors.tbtnglobal.caption
msgid "Use (and edit) &global scheme settings"
msgstr "Nutze (und bearbeite) all&gemeine Schemaeinstellungen"

#: tfrmoptionseditorcolors.tbtnlocal.caption
msgid "Use &local scheme settings"
msgstr "Nutze &lokale Schemaeinstellungen"

#: tfrmoptionseditorcolors.textboldcheckbox.caption
msgid "&Bold"
msgstr "&Fett"

#: tfrmoptionseditorcolors.textboldradioinvert.caption
msgctxt "tfrmoptionseditorcolors.textboldradioinvert.caption"
msgid "In&vert"
msgstr "&Umgekehrt"

#: tfrmoptionseditorcolors.textboldradiooff.caption
msgctxt "tfrmoptionseditorcolors.textboldradiooff.caption"
msgid "O&ff"
msgstr "Au&s"

#: tfrmoptionseditorcolors.textboldradioon.caption
msgctxt "tfrmoptionseditorcolors.textboldradioon.caption"
msgid "O&n"
msgstr "A&n"

#: tfrmoptionseditorcolors.textitaliccheckbox.caption
msgid "&Italic"
msgstr "Kurs&iv"

#: tfrmoptionseditorcolors.textitalicradioinvert.caption
msgctxt "tfrmoptionseditorcolors.textitalicradioinvert.caption"
msgid "In&vert"
msgstr "Um&gekehrt"

#: tfrmoptionseditorcolors.textitalicradiooff.caption
msgctxt "tfrmoptionseditorcolors.textitalicradiooff.caption"
msgid "O&ff"
msgstr "Au&s"

#: tfrmoptionseditorcolors.textitalicradioon.caption
msgctxt "tfrmoptionseditorcolors.textitalicradioon.caption"
msgid "O&n"
msgstr "A&n"

#: tfrmoptionseditorcolors.textstrikeoutcheckbox.caption
msgid "&Strike Out"
msgstr "Durchge&strichen"

#: tfrmoptionseditorcolors.textstrikeoutradioinvert.caption
msgctxt "tfrmoptionseditorcolors.textstrikeoutradioinvert.caption"
msgid "In&vert"
msgstr "Um&gekehrt"

#: tfrmoptionseditorcolors.textstrikeoutradiooff.caption
msgctxt "tfrmoptionseditorcolors.textstrikeoutradiooff.caption"
msgid "O&ff"
msgstr "Au&s"

#: tfrmoptionseditorcolors.textstrikeoutradioon.caption
msgctxt "tfrmoptionseditorcolors.textstrikeoutradioon.caption"
msgid "O&n"
msgstr "A&n"

#: tfrmoptionseditorcolors.textunderlinecheckbox.caption
msgid "&Underline"
msgstr "&Unterstreichen"

#: tfrmoptionseditorcolors.textunderlineradioinvert.caption
msgctxt "tfrmoptionseditorcolors.textunderlineradioinvert.caption"
msgid "In&vert"
msgstr "Um&gekehrt"

#: tfrmoptionseditorcolors.textunderlineradiooff.caption
msgctxt "tfrmoptionseditorcolors.textunderlineradiooff.caption"
msgid "O&ff"
msgstr "Au&s"

#: tfrmoptionseditorcolors.textunderlineradioon.caption
msgctxt "tfrmoptionseditorcolors.textunderlineradioon.caption"
msgid "O&n"
msgstr "A&n"

#: tfrmoptionsfavoritetabs.btnadd.caption
msgctxt "tfrmoptionsfavoritetabs.btnadd.caption"
msgid "Add..."
msgstr "Füge hinzu..."

#: tfrmoptionsfavoritetabs.btndelete.caption
msgctxt "tfrmoptionsfavoritetabs.btndelete.caption"
msgid "Delete..."
msgstr "Lösche..."

#: tfrmoptionsfavoritetabs.btnimportexport.caption
msgid "Import/Export"
msgstr "Import/Export"

#: tfrmoptionsfavoritetabs.btninsert.caption
msgctxt "tfrmoptionsfavoritetabs.btninsert.caption"
msgid "Insert..."
msgstr "Einfügen..."

#: tfrmoptionsfavoritetabs.btnrename.caption
msgctxt "tfrmoptionsfavoritetabs.btnrename.caption"
msgid "Rename"
msgstr "Umbenennen"

#: tfrmoptionsfavoritetabs.btnsort.caption
msgctxt "tfrmoptionsfavoritetabs.btnsort.caption"
msgid "Sort..."
msgstr "Sortieren..."

#: tfrmoptionsfavoritetabs.cbexistingtabstokeep.text
msgctxt "tfrmoptionsfavoritetabs.cbexistingtabstokeep.text"
msgid "None"
msgstr "Nichts"

#: tfrmoptionsfavoritetabs.cbfullexpandtree.caption
msgctxt "tfrmoptionsfavoritetabs.cbfullexpandtree.caption"
msgid "Always expand tree"
msgstr "Struktur immer aufklappen"

#: tfrmoptionsfavoritetabs.cbsavedirhistory.text
msgctxt "tfrmoptionsfavoritetabs.cbsavedirhistory.text"
msgid "No"
msgstr "Nein"

#: tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text
msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text"
msgid "Left"
msgstr "Links"

#: tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text
msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text"
msgid "Right"
msgstr "Rechts"

#: tfrmoptionsfavoritetabs.gbfavoritetabs.caption
msgid "Favorite Tabs list (reorder by drag && drop)"
msgstr "Liste der Favoriten-Tab (umsortieren durch Drag && Drop)"

#: tfrmoptionsfavoritetabs.gbfavoritetabsotheroptions.caption
msgctxt "tfrmoptionsfavoritetabs.gbfavoritetabsotheroptions.caption"
msgid "Other options"
msgstr "Andere Optionen"

#: tfrmoptionsfavoritetabs.gpsavedtabsrestorationaction.caption
msgid "What to restore where for the selected entry:"
msgstr "Was wo wiederhergestellt werden soll für den gewählten Eintrag:"

#: tfrmoptionsfavoritetabs.lblexistingtabstokeep.caption
msgid "Existing tabs to keep:"
msgstr "Existierende Tabs die erhalten bleiben sollen:"

#: tfrmoptionsfavoritetabs.lblsavedirhistory.caption
msgid "Save dir history:"
msgstr "Verzeichnisverlauf speichern:"

#: tfrmoptionsfavoritetabs.lbltargetpanelleftsavedtabs.caption
msgid "Tabs saved on left to be restored to:"
msgstr "Links gespeicherte Tabs dort wiederherstellen:"

#: tfrmoptionsfavoritetabs.lbltargetpanelrightsavedtabs.caption
msgid "Tabs saved on right to be restored to:"
msgstr "Rechts gespeicherte Tabs dort wiederherstellen:"

#: tfrmoptionsfavoritetabs.menuitem1.caption
msgctxt "tfrmoptionsfavoritetabs.menuitem1.caption"
msgid "-"
msgstr "-"

#: tfrmoptionsfavoritetabs.menuitem2.caption
msgctxt "tfrmoptionsfavoritetabs.menuitem2.caption"
msgid "-"
msgstr "-"

#: tfrmoptionsfavoritetabs.miaddseparator.caption
msgctxt "tfrmoptionsfavoritetabs.miaddseparator.caption"
msgid "a separator"
msgstr "Ein Trennzeichen"

#: tfrmoptionsfavoritetabs.miaddseparator2.caption
msgid "Add separator"
msgstr "Trennzeichen hinzufügen"

#: tfrmoptionsfavoritetabs.miaddsubmenu.caption
msgctxt "tfrmoptionsfavoritetabs.miaddsubmenu.caption"
msgid "sub-menu"
msgstr "Untermenü"

#: tfrmoptionsfavoritetabs.miaddsubmenu2.caption
msgctxt "tfrmoptionsfavoritetabs.miaddsubmenu2.caption"
msgid "Add sub-menu"
msgstr "Füge Untermenü hinzu"

#: tfrmoptionsfavoritetabs.micollapseall.caption
msgctxt "tfrmoptionsfavoritetabs.micollapseall.caption"
msgid "Collapse all"
msgstr "Alle zusammenfalten"

#: tfrmoptionsfavoritetabs.micurrentlevelofitemonly.caption
msgctxt "tfrmoptionsfavoritetabs.micurrentlevelofitemonly.caption"
msgid "...current level of item(s) selected only"
msgstr "... aktuelles Level an markierten Einträgen"

#: tfrmoptionsfavoritetabs.micutselection.caption
msgctxt "tfrmoptionsfavoritetabs.micutselection.caption"
msgid "Cut"
msgstr "Ausschneiden"

#: tfrmoptionsfavoritetabs.mideleteallfavoritetabs.caption
msgctxt "tfrmoptionsfavoritetabs.mideleteallfavoritetabs.caption"
msgid "delete all!"
msgstr "Lösche alle!"

#: tfrmoptionsfavoritetabs.mideletecompletesubmenu.caption
msgctxt "tfrmoptionsfavoritetabs.mideletecompletesubmenu.caption"
msgid "sub-menu and all its elements"
msgstr "Untermenü und alle seine Elemente"

#: tfrmoptionsfavoritetabs.mideletejustsubmenu.caption
msgctxt "tfrmoptionsfavoritetabs.mideletejustsubmenu.caption"
msgid "just sub-menu but keep elements"
msgstr "Nur das Untermenü, nicht seine Elemente"

#: tfrmoptionsfavoritetabs.mideleteselectedentry.caption
msgctxt "tfrmoptionsfavoritetabs.mideleteselectedentry.caption"
msgid "selected item"
msgstr "Gewählte Einträge"

#: tfrmoptionsfavoritetabs.mideleteselectedentry2.caption
msgctxt "tfrmoptionsfavoritetabs.mideleteselectedentry2.caption"
msgid "Delete selected item"
msgstr "Lösche gewählte Einträge"

#: tfrmoptionsfavoritetabs.miexporttolegacytabsfile.caption
msgid "Export selection to legacy .tab file(s)"
msgstr "Auswahl in veraltete .tab Datei(en) exportieren"

#: tfrmoptionsfavoritetabs.mifavoritetabstestmenu.caption
msgid "FavoriteTabsTestMenu"
msgstr ""

#: tfrmoptionsfavoritetabs.miimportlegacytabfilesaccsetting.caption
msgid "Import legacy .tab file(s) according to default setting"
msgstr "Veraltete .tab Datei nach Standardart importieren"

#: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos.caption
msgctxt "tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos.caption"
msgid "Import legacy .tab file(s) at selected position"
msgstr "Veraltete .tab Datei(en) an gewählte Position importieren"

#: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption
msgctxt "tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption"
msgid "Import legacy .tab file(s) at selected position"
msgstr "Veraltete .tab Datei(en) an gewählte Position importieren"

#: tfrmoptionsfavoritetabs.miimportlegacytabfilesinsubatpos.caption
msgid "Import legacy .tab file(s) at selected position in a sub menu"
msgstr "Veraltete .tab Datei(en) an gewählte Position in ein Untermenü importieren"

#: tfrmoptionsfavoritetabs.miinsertseparator.caption
msgid "Insert separator"
msgstr "Trennzeichen einfügen"

#: tfrmoptionsfavoritetabs.miinsertsubmenu.caption
msgid "Insert sub-menu"
msgstr "Untermenü einfügen"

#: tfrmoptionsfavoritetabs.miopenallbranches.caption
msgctxt "tfrmoptionsfavoritetabs.miopenallbranches.caption"
msgid "Open all branches"
msgstr "Alle Zweige öffnen"

#: tfrmoptionsfavoritetabs.mipasteselection.caption
msgctxt "tfrmoptionsfavoritetabs.mipasteselection.caption"
msgid "Paste"
msgstr "Einfügen"

#: tfrmoptionsfavoritetabs.mirename.caption
msgctxt "tfrmoptionsfavoritetabs.mirename.caption"
msgid "Rename"
msgstr "Umbenennen"

#: tfrmoptionsfavoritetabs.miseparator1.caption
msgctxt "tfrmoptionsfavoritetabs.miseparator1.caption"
msgid "-"
msgstr "-"

#: tfrmoptionsfavoritetabs.miseparator10.caption
msgctxt "tfrmoptionsfavoritetabs.miseparator10.caption"
msgid "-"
msgstr "-"

#: tfrmoptionsfavoritetabs.miseparator11.caption
msgctxt "tfrmoptionsfavoritetabs.miseparator11.caption"
msgid "-"
msgstr "-"

#: tfrmoptionsfavoritetabs.miseparator2.caption
msgctxt "tfrmoptionsfavoritetabs.miseparator2.caption"
msgid "-"
msgstr "-"

#: tfrmoptionsfavoritetabs.miseparator3.caption
msgctxt "tfrmoptionsfavoritetabs.miseparator3.caption"
msgid "-"
msgstr "-"

#: tfrmoptionsfavoritetabs.miseparator7.caption
msgctxt "tfrmoptionsfavoritetabs.miseparator7.caption"
msgid "-"
msgstr "-"

#: tfrmoptionsfavoritetabs.miseparator8.caption
msgctxt "tfrmoptionsfavoritetabs.miseparator8.caption"
msgid "-"
msgstr "-"

#: tfrmoptionsfavoritetabs.miseparator9.caption
msgctxt "tfrmoptionsfavoritetabs.miseparator9.caption"
msgid "-"
msgstr "-"

#: tfrmoptionsfavoritetabs.misorteverything.caption
msgctxt "tfrmoptionsfavoritetabs.misorteverything.caption"
msgid "...everything, from A to Z!"
msgstr "... alles von A bis Z!"

#: tfrmoptionsfavoritetabs.misortsinglegroup.caption
msgctxt "tfrmoptionsfavoritetabs.misortsinglegroup.caption"
msgid "...single group of item(s) only"
msgstr "... nur einzelne Gruppe von Einträgen"

#: tfrmoptionsfavoritetabs.misortsinglegroup2.caption
msgctxt "tfrmoptionsfavoritetabs.misortsinglegroup2.caption"
msgid "Sort single group of item(s) only"
msgstr "Sortiere nur einzelne Gruppe von Einträgen"

#: tfrmoptionsfavoritetabs.misortsinglesubmenu.caption
msgctxt "tfrmoptionsfavoritetabs.misortsinglesubmenu.caption"
msgid "...content of submenu(s) selected, no sublevel"
msgstr "...Inhalt von Untermenüs gewählt, aber keine tieferen Level"

#: tfrmoptionsfavoritetabs.misortsubmenuandsublevel.caption
msgctxt "tfrmoptionsfavoritetabs.misortsubmenuandsublevel.caption"
msgid "...content of submenu(s) selected and all sublevels"
msgstr "...Inhalt von Untermenüs ausgewählt, auch alle tiferen Level"

#: tfrmoptionsfavoritetabs.mitestresultingfavoritetabsmenu.caption
msgctxt "tfrmoptionsfavoritetabs.mitestresultingfavoritetabsmenu.caption"
msgid "Test resulting menu"
msgstr "Menü aus Testergebnissen"

#: tfrmoptionsfileassoc.btnaddact.caption
msgctxt "tfrmoptionsfileassoc.btnaddact.caption"
msgid "Add"
msgstr "Hinzufügen"

#: tfrmoptionsfileassoc.btnaddext.caption
msgctxt "tfrmoptionsfileassoc.btnaddext.caption"
msgid "&Add"
msgstr "&Hinzufügen"

#: tfrmoptionsfileassoc.btnaddnewtype.caption
msgctxt "tfrmoptionsfileassoc.btnaddnewtype.caption"
msgid "A&dd"
msgstr "&Hinzufügen"

#: tfrmoptionsfileassoc.btncloneact.caption
msgid "Clone"
msgstr "Klonen"

#: tfrmoptionsfileassoc.btndownact.caption
msgctxt "tfrmoptionsfileassoc.btndownact.caption"
msgid "&Down"
msgstr "&Abwärts"

#: tfrmoptionsfileassoc.btneditext.caption
msgctxt "tfrmoptionsfileassoc.btneditext.caption"
msgid "Edit"
msgstr "Bea&rbeiten"

#: tfrmoptionsfileassoc.btninsertact.caption
msgctxt "tfrmoptionsfileassoc.btninsertact.caption"
msgid "Insert"
msgstr "Einfügen"

#: tfrmoptionsfileassoc.btninsertext.caption
msgctxt "tfrmoptionsfileassoc.btninsertext.caption"
msgid "Insert"
msgstr "Einfügen"

#: tfrmoptionsfileassoc.btnremoveact.caption
msgid "Remo&ve"
msgstr "Ent&fernen"

#: tfrmoptionsfileassoc.btnremoveext.caption
msgctxt "tfrmoptionsfileassoc.btnremoveext.caption"
msgid "Re&move"
msgstr "Ent&fernen"

#: tfrmoptionsfileassoc.btnremovetype.caption
msgctxt "tfrmoptionsfileassoc.btnremovetype.caption"
msgid "&Remove"
msgstr "Entfe&rnen"

#: tfrmoptionsfileassoc.btnrenametype.caption
msgctxt "tfrmoptionsfileassoc.btnrenametype.caption"
msgid "R&ename"
msgstr "Umb&enennen"

#: tfrmoptionsfileassoc.btnupact.caption
msgctxt "tfrmoptionsfileassoc.btnupact.caption"
msgid "&Up"
msgstr "&Hoch"

#: tfrmoptionsfileassoc.destartpath.hint
msgid "Starting path of the command. Never quote this string."
msgstr "Startpfad des Befehles. Nicht in Anführungstriche setzen!"

#: tfrmoptionsfileassoc.edbactionname.hint
msgid "Name of the action. It is never passed to the system, it's just a mnemonic name chosen by you, for you"
msgstr "Name der Aktion. Wird nicht an das System übergeben, sondern dient nur der Identifizierung."

#: tfrmoptionsfileassoc.edtparams.hint
#, fuzzy
#| msgid "Parameter to pass to the command. Long filename with spaces should be quoted."
msgid "Parameter to pass to the command. Long filename with spaces should be quoted (manually entering)."
msgstr "Parameter für den Befehl. Lange Pfade mit Leerzeichen sollten in Anführungsstriche gesetzt werden."

#: tfrmoptionsfileassoc.fnecommand.hint
#, fuzzy
#| msgid "Command to execute. Long filename with space should be quoted."
msgid "Command to execute. Never quote this string."
msgstr "Befehl zum Ausführen. Lange Pfade mit Leerzeichen sollten in Anführungsstriche gesetzt werden."

#: tfrmoptionsfileassoc.gbactiondescription.caption
msgid "Action description:"
msgstr "Beschreibung der Aktion"

#: tfrmoptionsfileassoc.gbactions.caption
msgctxt "tfrmoptionsfileassoc.gbactions.caption"
msgid "Actions"
msgstr "Aktionen"

#: tfrmoptionsfileassoc.gbexts.caption
msgctxt "tfrmoptionsfileassoc.gbexts.caption"
msgid "Extensions"
msgstr "Endungen"

#: tfrmoptionsfileassoc.gbexts.hint
msgid "Can be sorted by drag & drop"
msgstr "Kann durch Drag & Drop sortiert werden"

#: tfrmoptionsfileassoc.gbfiletypes.caption
msgctxt "tfrmoptionsfileassoc.gbfiletypes.caption"
msgid "File types"
msgstr "Dateitypen"

#: tfrmoptionsfileassoc.gbicon.caption
msgctxt "tfrmoptionsfileassoc.gbicon.caption"
msgid "Icon"
msgstr "Icon"

#: tfrmoptionsfileassoc.lbactions.hint
msgid "Actions may be sorted by drag & drop"
msgstr "Aktionen können durch Drag & Drop angeordnet werden"

#: tfrmoptionsfileassoc.lbexts.hint
msgid "Extensions may be sorted by drag & drop"
msgstr "Endungen können durch Drag & Drop angeordnet werden"

#: tfrmoptionsfileassoc.lbfiletypes.hint
msgid "File types may be sorted by drag & drop"
msgstr "Dateitypen können durch Drag & Drop angeordnet werden"

#: tfrmoptionsfileassoc.lblaction.caption
msgctxt "tfrmoptionsfileassoc.lblaction.caption"
msgid "Action name:"
msgstr "Name der Aktion:"

#: tfrmoptionsfileassoc.lblcommand.caption
msgctxt "tfrmoptionsfileassoc.lblcommand.caption"
msgid "&Command:"
msgstr "&Befehl"

#: tfrmoptionsfileassoc.lblexternalparameters.caption
msgctxt "tfrmoptionsfileassoc.lblexternalparameters.caption"
msgid "Parameter&s:"
msgstr "&Parameter:"

#: tfrmoptionsfileassoc.lblstartpath.caption
msgctxt "tfrmoptionsfileassoc.lblstartpath.caption"
msgid "Start pat&h:"
msgstr "Start&pfad"

#: tfrmoptionsfileassoc.menuitem3.caption
msgid "Custom with..."
msgstr "Angepasst mit..."

#: tfrmoptionsfileassoc.micustom.caption
msgid "Custom"
msgstr "Angepasst"

#: tfrmoptionsfileassoc.miedit.caption
msgctxt "tfrmoptionsfileassoc.miedit.caption"
msgid "Edit"
msgstr "Bea&rbeiten"

#: tfrmoptionsfileassoc.mieditor.caption
msgctxt "tfrmoptionsfileassoc.mieditor.caption"
msgid "Open in Editor"
msgstr "im Editor öffnen"

#: tfrmoptionsfileassoc.mieditwith.caption
msgid "Edit with..."
msgstr "Bearbeiten mit..."

#: tfrmoptionsfileassoc.migetoutputfromcommand.caption
msgctxt "tfrmoptionsfileassoc.migetoutputfromcommand.caption"
msgid "Get output from command"
msgstr "Ausgabe aus Konsolen-Fenster entnehmen"

#: tfrmoptionsfileassoc.miinternaleditor.caption
msgid "Open in Internal Editor"
msgstr "Im internen Editor öffnen"

#: tfrmoptionsfileassoc.miinternalviewer.caption
msgid "Open in Internal Viewer"
msgstr "Im internen Betrachter öffnen"

#: tfrmoptionsfileassoc.miopen.caption
msgctxt "tfrmoptionsfileassoc.miopen.caption"
msgid "Open"
msgstr "Öffnen"

#: tfrmoptionsfileassoc.miopenwith.caption
msgid "Open with..."
msgstr "Öffnen mit..."

#: tfrmoptionsfileassoc.mishell.caption
msgctxt "tfrmoptionsfileassoc.mishell.caption"
msgid "Run in terminal"
msgstr "In Konsolen-Fenster ausführen"

#: tfrmoptionsfileassoc.miview.caption
msgctxt "tfrmoptionsfileassoc.miview.caption"
msgid "View"
msgstr "Betrachten"

#: tfrmoptionsfileassoc.miviewer.caption
msgctxt "tfrmoptionsfileassoc.miviewer.caption"
msgid "Open in Viewer"
msgstr "In Betrachter öffnen"

#: tfrmoptionsfileassoc.miviewwith.caption
msgid "View with..."
msgstr "Betrachten mit..."

#: tfrmoptionsfileassoc.sbtnicon.hint
msgid "Click me to change icon!"
msgstr "Hier klicken um das Icon zu ändern!"

#: tfrmoptionsfileassocextra.cbexecuteviashell.caption
msgctxt "tfrmoptionsfileassocextra.cbexecuteviashell.caption"
msgid "Execute via shell"
msgstr "Auf der Befehlszeile ausführen"

#: tfrmoptionsfileassocextra.cbextendedcontextmenu.caption
msgid "Extended context menu"
msgstr "Erweitertes Kontextmenü"

#: tfrmoptionsfileassocextra.cbextendedcontextmenu.hint
msgctxt "tfrmoptionsfileassocextra.cbextendedcontextmenu.hint"
msgid "When accessing file association, offer to add current selected file if not already included in a configured file type"
msgstr "Wenn die Dateityp-Verknüpfung genutzt wird, anbieten die aktuelle Datei hinzuzfügen, wenn nicht bereits in einem konfigurierten Typ enthalten"

#: tfrmoptionsfileassocextra.cbincludeconfigfileassoc.caption
msgid "File association configuration"
msgstr "Konfiguration der Dateitypen"

#: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.caption
msgid "Offer to add selection to file association when not included already"
msgstr "Anbieten die Auswahl zur Dateityp-Verknüpfung hinzuzfügen, wenn nicht bereits enthalten"

#: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint
msgctxt "tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint"
msgid "When accessing file association, offer to add current selected file if not already included in a configured file type"
msgstr "Wenn die Dateityp-Verknüpfung genutzt wird, anbieten die aktuelle Datei hinzuzfügen, wenn nicht bereits in einem konfigurierten Tpy enthalten"

#: tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption
msgctxt "tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption"
msgid "Execute via terminal and close"
msgstr "Im Terminal ausführen und schließen"

#: tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption
msgctxt "tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption"
msgid "Execute via terminal and stay open"
msgstr "Im Terminal ausführen und geöffnet lassen"

#: tfrmoptionsfileassocextra.gbextendedcontextmenuoptions.caption
msgid "Extended options items:"
msgstr "Einträge für erweiterte Optionen:"

#: tfrmoptionsfileoperations.bvlconfirmations.caption
msgctxt "tfrmoptionsfileoperations.bvlconfirmations.caption"
msgid "Show confirmation window for:"
msgstr "Bestätigungsdialog zeigen für:"

#: tfrmoptionsfileoperations.cbcopyconfirmation.caption
msgid "Cop&y operation"
msgstr "Kop&ieren"

#: tfrmoptionsfileoperations.cbdeleteconfirmation.caption
msgid "&Delete operation"
msgstr "&Löschen"

#: tfrmoptionsfileoperations.cbdeletetotrash.caption
msgctxt "TFRMOPTIONSFILEOPERATIONS.CBDELETETOTRASH.CAPTION"
msgid "Dele&te to recycle bin (Shift key reverses this setting)"
msgstr "Löschen in den Papierkorb ('Umschalt'-Taste invertiert diese Funktion)"

#: tfrmoptionsfileoperations.cbdeletetotrashconfirmation.caption
msgid "D&elete to trash operation"
msgstr "In d&en Papierkorb verschieben"

#: tfrmoptionsfileoperations.cbdropreadonlyflag.caption
msgctxt "TFRMOPTIONSFILEOPERATIONS.CBDROPREADONLYFLAG.CAPTION"
msgid "D&rop readonly flag"
msgstr "Sch&reibschutz-Attribut entfernen"

#: tfrmoptionsfileoperations.cbmoveconfirmation.caption
msgid "&Move operation"
msgstr "&Verschieben"

#: tfrmoptionsfileoperations.cbprocesscomments.caption
msgctxt "TFRMOPTIONSFILEOPERATIONS.CBPROCESSCOMMENTS.CAPTION"
msgid "&Process comments with files/folders"
msgstr "K&ommentare von Dateien/Verzeichnissen mitbearbeiten"

#: tfrmoptionsfileoperations.cbrenameselonlyname.caption
msgctxt "TFRMOPTIONSFILEOPERATIONS.CBRENAMESELONLYNAME.CAPTION"
msgid "Select &file name without extension when renaming"
msgstr "&Bei Umbenennen den Dateinamen ohne Endung selektieren"

#: tfrmoptionsfileoperations.cbshowcopytabselectpanel.caption
msgctxt "TFRMOPTIONSFILEOPERATIONS.CBSHOWCOPYTABSELECTPANEL.CAPTION"
msgid "Sho&w tab select panel in copy/move dialog"
msgstr "&Zeige Auswahldialog für Tabs im Kopieren/Verschieben-Dialog"

#: tfrmoptionsfileoperations.cbskipfileoperror.caption
msgctxt "TFRMOPTIONSFILEOPERATIONS.CBSKIPFILEOPERROR.CAPTION"
msgid "S&kip file operations errors and write them to log window"
msgstr "&Fehler bei Datei-Operationen ignorieren und sie im Log-Fenster anzeigen"

#: tfrmoptionsfileoperations.gbexecutingoperations.caption
msgid "Executing operations"
msgstr "Führe Operationen aus"

#: tfrmoptionsfileoperations.gbuserinterface.caption
msgid "User interface"
msgstr "Nutzeroberfläche"

#: tfrmoptionsfileoperations.lblbuffersize.caption
msgid "&Buffer size for file operations (in KB):"
msgstr "&Puffergröße für Dateioperationen (in KB)"

#: tfrmoptionsfileoperations.lblhashbuffersize.caption
msgid "Buffer size for &hash calculation (in KB):"
msgstr "Puffergröße für die &Hash-Kalkulation (in KB):"

#: tfrmoptionsfileoperations.lblprogresskind.caption
msgid "Show operations progress &initially in"
msgstr "Ze&ige Operationsfortschritt in"

#: tfrmoptionsfileoperations.lbltypeofduplicatedrename.caption
msgctxt "tfrmoptionsfileoperations.lbltypeofduplicatedrename.caption"
msgid "Duplicated name auto-rename style:"
msgstr "Dateiname bei Duplizieren erweitern:"

#: tfrmoptionsfileoperations.lblwipepassnumber.caption
msgctxt "TFRMOPTIONSFILEOPERATIONS.LBLWIPEPASSNUMBER.CAPTION"
msgid "&Number of wipe passes:"
msgstr "A&nzahl der Überschreibvorgänge"

#: tfrmoptionsfilepanelscolors.btnbackcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNBACKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"

#: tfrmoptionsfilepanelscolors.btnbackcolor2.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNBACKCOLOR2.CAPTION"
msgid ">>"
msgstr ">>"

#: tfrmoptionsfilepanelscolors.btncursorbordercolor.caption
msgctxt "tfrmoptionsfilepanelscolors.btncursorbordercolor.caption"
msgid ">>"
msgstr ">>"

#: tfrmoptionsfilepanelscolors.btncursorcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORCOLOR.CAPTION"
msgid ">>"
msgstr ">>"

#: tfrmoptionsfilepanelscolors.btncursortext.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORTEXT.CAPTION"
msgid ">>"
msgstr ">>"

#: tfrmoptionsfilepanelscolors.btnforecolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNFORECOLOR.CAPTION"
msgid ">>"
msgstr ">>"

#: tfrmoptionsfilepanelscolors.btninactivecursorcolor.caption
msgctxt "tfrmoptionsfilepanelscolors.btninactivecursorcolor.caption"
msgid ">>"
msgstr ">>"

#: tfrmoptionsfilepanelscolors.btninactivemarkcolor.caption
msgctxt "tfrmoptionsfilepanelscolors.btninactivemarkcolor.caption"
msgid ">>"
msgstr ">>"

#: tfrmoptionsfilepanelscolors.btnindbackcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINDBACKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"

#: tfrmoptionsfilepanelscolors.btnindcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINDCOLOR.CAPTION"
msgid ">>"
msgstr ">>"

#: tfrmoptionsfilepanelscolors.btnmarkcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNMARKCOLOR.CAPTION"
msgid ">>"
msgstr ">>"

#: tfrmoptionsfilepanelscolors.btnresettodcdefault.caption
msgid "Reset to DC default"
msgstr "Auf Standard-Einstellungen zurücksetzen"

#: tfrmoptionsfilepanelscolors.cballowovercolor.caption
msgctxt "tfrmoptionsfilepanelscolors.cballowovercolor.caption"
msgid "Allow Overcolor"
msgstr "Erlaube Farb-Überschneidung"

#: tfrmoptionsfilepanelscolors.cbbuseframecursor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.CBBUSEFRAMECURSOR.CAPTION"
msgid "Use &Frame Cursor"
msgstr "&Cursor nur als Rahmen"

#: tfrmoptionsfilepanelscolors.cbbusegradientind.caption
msgid "Use &Gradient Indicator"
msgstr "Ver&wende Farbverlauf als Indikator"

#: tfrmoptionsfilepanelscolors.cbbuseinactiveselcolor.caption
msgid "Use Inactive Sel Color"
msgstr "Nutze inaktive Sel-Farbe"

#: tfrmoptionsfilepanelscolors.cbbuseinvertedselection.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.CBBUSEINVERTEDSELECTION.CAPTION"
msgid "U&se Inverted Selection"
msgstr "Invertierte Au&swahl nutzen"

#: tfrmoptionsfilepanelscolors.cbusecursorborder.caption
msgctxt "tfrmoptionsfilepanelscolors.cbusecursorborder.caption"
msgid "Cursor border"
msgstr "Cursor Begrenzung"

#: tfrmoptionsfilepanelscolors.dbfreespaceindicator.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.DBFREESPACEINDICATOR.CAPTION"
msgid "Drive Free Space Indicator"
msgstr "Indikator für freien Speicherplatz auf Laufwerken"

#: tfrmoptionsfilepanelscolors.lblbackgroundcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLBACKGROUNDCOLOR.CAPTION"
msgid "Bac&kground:"
msgstr "Hinter&grund:"

#: tfrmoptionsfilepanelscolors.lblbackgroundcolor2.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLBACKGROUNDCOLOR2.CAPTION"
msgid "Backg&round 2:"
msgstr "Hinte&rgrund 2:"

#: tfrmoptionsfilepanelscolors.lblcursorcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLCURSORCOLOR.CAPTION"
msgid "C&ursor Color:"
msgstr "C&ursorfarbe"

#: tfrmoptionsfilepanelscolors.lblcursortext.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLCURSORTEXT.CAPTION"
msgid "Cursor Te&xt:"
msgstr "Cursorte&xt"

#: tfrmoptionsfilepanelscolors.lblinactivecursorcolor.caption
msgctxt "tfrmoptionsfilepanelscolors.lblinactivecursorcolor.caption"
msgid "Inactive Cursor Color:"
msgstr "Inaktive Cursor-Farbe"

#: tfrmoptionsfilepanelscolors.lblinactivemarkcolor.caption
msgctxt "tfrmoptionsfilepanelscolors.lblinactivemarkcolor.caption"
msgid "Inactive Mark Color:"
msgstr "Inaktive Markierungsfarbe"

#: tfrmoptionsfilepanelscolors.lblinactivepanelbrightness.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLINACTIVEPANELBRIGHTNESS.CAPTION"
msgid "&Brightness level of inactive panel"
msgstr "&Helligkeitswert des inaktiven Panels"

#: tfrmoptionsfilepanelscolors.lblindbackcolor.caption
msgid "In&dicator Back Color:"
msgstr "Hintergrun&dfarbe für Indikator"

#: tfrmoptionsfilepanelscolors.lblindcolor.caption
msgid "&Indicator Fore Color:"
msgstr "Vordergrundfarbe für &Indikator:"

#: tfrmoptionsfilepanelscolors.lblmarkcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLMARKCOLOR.CAPTION"
msgid "&Mark Color:"
msgstr "&Markierungsfarbe"

#: tfrmoptionsfilepanelscolors.lblpreview.caption
msgid "Below is a preview. You may move cursor, select file and get immediately an actual look and feel of the various settings."
msgstr "Vorschau: Cursor bewegen und Dateien markieren, um einen sofortigen Eindruck von den verschieden Einstellungen zu bekommen."

#: tfrmoptionsfilepanelscolors.lbltextcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLTEXTCOLOR.CAPTION"
msgid "T&ext Color:"
msgstr "T&extfarbe"

#: tfrmoptionsfilesearch.cbinitiallyclearfilemask.caption
msgid "When launching file search, clear file mask filter"
msgstr "Bei Starten der Dateisuche Filter Dateimaske leeren"

#: tfrmoptionsfilesearch.cbpartialnamesearch.caption
msgid "&Search for part of file name"
msgstr "&Suche nach Teil des Dateinamens"

#: tfrmoptionsfilesearch.cbshowmenubarinfindfiles.caption
msgid "Show menu bar in \"Find files\""
msgstr "Menue-Bar in \"Dateisuche\" anzeigen"

#: tfrmoptionsfilesearch.dbtextsearch.caption
msgid "Text search in files"
msgstr "Textsuche in Dateien"

#: tfrmoptionsfilesearch.gbfilesearch.caption
msgctxt "tfrmoptionsfilesearch.gbfilesearch.caption"
msgid "File search"
msgstr "Dateien suchen"

#: tfrmoptionsfilesearch.lblnewsearchfilters.caption
msgid "Current filters with \"New search\" button:"
msgstr "Aktuelle Filter mit \"Neue Suche\" Button:"

#: tfrmoptionsfilesearch.lblsearchdefaulttemplate.caption
msgid "Default search template:"
msgstr "Standardvorlage für Suche:"

#: tfrmoptionsfilesearch.rbusemmapinsearch.caption
msgid "Use memory mapping for search te&xt in files"
msgstr "Nutze Memor&y-Mapping zur Textsuche in Dateien"

#: tfrmoptionsfilesearch.rbusestreaminsearch.caption
msgid "&Use stream for search text in files"
msgstr "N&utze Stream zur Textsuche in Dateien"

#: tfrmoptionsfilesviews.btnaddattribute.caption
#, fuzzy
msgctxt "tfrmoptionsfilesviews.btnaddattribute.caption"
msgid "&Add"
msgstr "&Hinzufügen"

#: tfrmoptionsfilesviews.btnattrshelp.caption
#, fuzzy
msgctxt "tfrmoptionsfilesviews.btnattrshelp.caption"
msgid "&Help"
msgstr "&Hilfe"

#: tfrmoptionsfilesviews.cbdblclicktoparent.caption
msgid "Enable changing to &parent folder when double-clicking on empty part of file view"
msgstr ""

#: tfrmoptionsfilesviews.cbdelayloadingtabs.caption
msgid "Do&n't load file list until a tab is activated"
msgstr "Dateiliste &nicht laden bis ein Tab aktiviert ist"

#: tfrmoptionsfilesviews.cbdirbrackets.caption
msgctxt "TFRMOPTIONSFILESVIEWS.CBDIRBRACKETS.CAPTION"
msgid "S&how square brackets around directories"
msgstr "Zeige eckige Klammern um Verzeic&hnisse"

#: tfrmoptionsfilesviews.cbhighlightupdatedfiles.caption
msgid "Hi&ghlight new and updated files"
msgstr "Ma&rkiere neue und aktualisierte Dateien"

#: tfrmoptionsfilesviews.cbinplacerename.caption
msgid "Enable inplace &renaming when clicking twice on a name"
msgstr "Sofortiges Umbenennen bei zweimaligem Anklicken eines Dateinamens ermöglichen"

#: tfrmoptionsfilesviews.cblistfilesinthread.caption
msgctxt "TFRMOPTIONSFILESVIEWS.CBLISTFILESINTHREAD.CAPTION"
msgid "Load &file list in separate thread"
msgstr "&Dateiliste in eigenem Prozess starten"

#: tfrmoptionsfilesviews.cbloadiconsseparately.caption
msgctxt "TFRMOPTIONSFILESVIEWS.CBLOADICONSSEPARATELY.CAPTION"
msgid "Load icons af&ter file list"
msgstr "Icons nach Da&teiliste laden"

#: tfrmoptionsfilesviews.cbshowsystemfiles.caption
msgctxt "TFRMOPTIONSFILESVIEWS.CBSHOWSYSTEMFILES.CAPTION"
msgid "Show s&ystem and hidden files"
msgstr "Zeige versteckte und S&ystemdateien"

#: tfrmoptionsfilesviews.cbspacemovesdown.caption
msgctxt "TFRMOPTIONSFILESVIEWS.CBSPACEMOVESDOWN.CAPTION"
msgid "&When selecting files with <SPACEBAR>, move down to next file (as with <INSERT>)"
msgstr "&Wenn Dateien mit der <Leertaste> ausgewählt werden, zur nächsten Datei wechseln (wie mit <Einfügen>)"

#: tfrmoptionsfilesviews.chkmarkmaskfilterwindows.caption
msgctxt "tfrmoptionsfilesviews.chkmarkmaskfilterwindows.caption"
msgid "Windows style filter when marking files (\"*.*\" also select files without extension, etc.)"
msgstr ""

#: tfrmoptionsfilesviews.chkmarkmaskshowattribute.caption
msgctxt "tfrmoptionsfilesviews.chkmarkmaskshowattribute.caption"
msgid "Use an independent attribute filter in mask input dialog each time"
msgstr ""

#: tfrmoptionsfilesviews.gbformatting.caption
msgid "Formatting"
msgstr "Format"

#: tfrmoptionsfilesviews.gbmarking.caption
msgid "Marking/Unmarking entries"
msgstr ""

#: tfrmoptionsfilesviews.gbsorting.caption
msgctxt "TFRMOPTIONSFILESVIEWS.GBSORTING.CAPTION"
msgid "Sorting"
msgstr "Sortierung"

#: tfrmoptionsfilesviews.lbattributemask.caption
msgctxt "tfrmoptionsfilesviews.lbattributemask.caption"
msgid "Default attribute mask value to use:"
msgstr ""

#: tfrmoptionsfilesviews.lblcasesensitivity.caption
msgid "Case s&ensitivity:"
msgstr "Groß-/Kleinschr&eibung:"

#: tfrmoptionsfilesviews.lbldatetimeexample.caption
msgid "Incorrect format"
msgstr "Falsches Format"

#: tfrmoptionsfilesviews.lbldatetimeformat.caption
msgctxt "TFRMOPTIONSFILESVIEWS.LBLDATETIMEFORMAT.CAPTION"
msgid "&Date and time format:"
msgstr "&Datums- und Zeitformat"

#: tfrmoptionsfilesviews.lblfilesizeformat.caption
msgid "File si&ze format:"
msgstr "Format Dateigr&öße"

#: tfrmoptionsfilesviews.lblnewfilesposition.caption
#, fuzzy
#| msgid "&Insert new files"
msgid "&Insert new files:"
msgstr "Neue Date&ien einfügen"

#: tfrmoptionsfilesviews.lblsortfoldermode.caption
msgid "So&rting directories:"
msgstr "So&rtierung von Verzeichnissen:"

#: tfrmoptionsfilesviews.lblsortmethod.caption
msgctxt "TFRMOPTIONSFILESVIEWS.LBLSORTMETHOD.CAPTION"
msgid "&Sort method:"
msgstr "&Sortier&methode:"

#: tfrmoptionsfilesviews.lblupdatedfilesposition.caption
#, fuzzy
#| msgid "&Move updated files"
msgid "&Move updated files:"
msgstr "Aktualisierte Dateien verschiebe&n"

#: tfrmoptionsfiletypescolors.btnaddcategory.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNADDCATEGORY.CAPTION"
msgid "A&dd"
msgstr "&Hinzufügen"

#: tfrmoptionsfiletypescolors.btnapplycategory.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNAPPLYCATEGORY.CAPTION"
msgid "A&pply"
msgstr "&Übernehmen"

#: tfrmoptionsfiletypescolors.btncategorycolor.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNCATEGORYCOLOR.CAPTION"
msgid ">>"
msgstr ">>"

#: tfrmoptionsfiletypescolors.btndeletecategory.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNDELETECATEGORY.CAPTION"
msgid "D&elete"
msgstr "&Löschen"

#: tfrmoptionsfiletypescolors.btnsearchtemplate.hint
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNSEARCHTEMPLATE.HINT"
msgid "Template..."
msgstr "Vorlage..."

#: tfrmoptionsfiletypescolors.gbfiletypescolors.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.GBFILETYPESCOLORS.CAPTION"
msgid "File types colors (sort by drag&&drop)"
msgstr "Dateitypfarben (durch \"Drag && Drop\" anordnen)"

#: tfrmoptionsfiletypescolors.lblcategoryattr.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.LBLCATEGORYATTR.CAPTION"
msgid "Category a&ttributes:"
msgstr "Ka&tegorie der Attribute"

#: tfrmoptionsfiletypescolors.lblcategorycolor.caption
msgid "Category co&lor:"
msgstr "&Kategoriefarbe"

#: tfrmoptionsfiletypescolors.lblcategorymask.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.LBLCATEGORYMASK.CAPTION"
msgid "Category &mask:"
msgstr "Kategorie&maske"

#: tfrmoptionsfiletypescolors.lblcategoryname.caption
msgctxt "tfrmoptionsfiletypescolors.lblcategoryname.caption"
msgid "Category &name:"
msgstr "Kategorie&name"

#: tfrmoptionsfonts.btnpatheditfnt.caption
msgctxt "tfrmoptionsfonts.btnpatheditfnt.caption"
msgid "..."
msgstr "..."

#: tfrmoptionsfonts.btnsearchresultsfnt.caption
msgctxt "tfrmoptionsfonts.btnsearchresultsfnt.caption"
msgid "..."
msgstr "..."

#: tfrmoptionsfonts.btnselconsolefnt.caption
msgctxt "tfrmoptionsfonts.btnselconsolefnt.caption"
msgid "..."
msgstr "..."

#: tfrmoptionsfonts.btnseleditfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELEDITFNT.CAPTION"
msgid "..."
msgstr "..."

#: tfrmoptionsfonts.btnsellogfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELLOGFNT.CAPTION"
msgid "..."
msgstr "..."

#: tfrmoptionsfonts.btnselmainfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELMAINFNT.CAPTION"
msgid "..."
msgstr "..."

#: tfrmoptionsfonts.btnselviewerbookfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELVIEWERBOOKFNT.CAPTION"
msgid "..."
msgstr "..."

#: tfrmoptionsfonts.btnselviewfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELVIEWFNT.CAPTION"
msgid "..."
msgstr "..."

#: tfrmoptionsfonts.lblconsolefont.caption
msgid "&Console font"
msgstr "S&chriftart für Kommandozeilen-Fenster"

#: tfrmoptionsfonts.lbleditorfont.caption
msgctxt "TFRMOPTIONSFONTS.LBLEDITORFONT.CAPTION"
msgid "&Editor font"
msgstr "Schriftart für &Editor"

#: tfrmoptionsfonts.lbllogfont.caption
msgctxt "TFRMOPTIONSFONTS.LBLLOGFONT.CAPTION"
msgid "&Log font"
msgstr "Schriftart für &Log-Dateien"

#: tfrmoptionsfonts.lblmainfont.caption
msgctxt "TFRMOPTIONSFONTS.LBLMAINFONT.CAPTION"
msgid "Main &font"
msgstr "Hauptschri&ftart"

#: tfrmoptionsfonts.lblpatheditfont.caption
msgid "Path font"
msgstr "Schriftart für Pfade"

#: tfrmoptionsfonts.lblsearchresultsfont.caption
msgid "Search results font"
msgstr "Schriftart für Suchergebnisse"

#: tfrmoptionsfonts.lblviewerbookfont.caption
msgctxt "TFRMOPTIONSFONTS.LBLVIEWERBOOKFONT.CAPTION"
msgid "Viewer&Book Font"
msgstr "Schriftart für die &buchartige Ansicht"

#: tfrmoptionsfonts.lblviewerfont.caption
msgctxt "TFRMOPTIONSFONTS.LBLVIEWERFONT.CAPTION"
msgid "&Viewer font"
msgstr "Schriftart für &Betrachter"

#: tfrmoptionshotkeys.actaddhotkey.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.actaddhotkey.caption"
msgid "Add &hotkey"
msgstr "Tastaturkürzel &hinzufügen"

#: tfrmoptionshotkeys.actcopy.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.actcopy.caption"
msgid "Copy"
msgstr "Kopieren"

#: tfrmoptionshotkeys.actdelete.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.actdelete.caption"
msgid "Delete"
msgstr "&Löschen"

#: tfrmoptionshotkeys.actdeletehotkey.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.actdeletehotkey.caption"
msgid "&Delete hotkey"
msgstr "&Tastaturkürzel löschen"

#: tfrmoptionshotkeys.actedithotkey.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.actedithotkey.caption"
msgid "&Edit hotkey"
msgstr "Tastaturkürz&el bearbeiten"

#: tfrmoptionshotkeys.actnextcategory.caption
msgid "Next category"
msgstr ""

#: tfrmoptionshotkeys.actpopupfilerelatedmenu.caption
msgid "Make popup the file related menu"
msgstr ""

#: tfrmoptionshotkeys.actpreviouscategory.caption
msgid "Previous category"
msgstr ""

#: tfrmoptionshotkeys.actrename.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.actrename.caption"
msgid "Rename"
msgstr "Umbenennen"

#: tfrmoptionshotkeys.actrestoredefault.caption
msgid "Restore DC default"
msgstr ""

#: tfrmoptionshotkeys.actsavenow.caption
msgid "Save now"
msgstr ""

#: tfrmoptionshotkeys.actsortbycommand.caption
msgid "Sort by command name"
msgstr ""

#: tfrmoptionshotkeys.actsortbyhotkeysgrouped.caption
msgid "Sort by hotkeys (grouped)"
msgstr ""

#: tfrmoptionshotkeys.actsortbyhotkeysoneperline.caption
msgid "Sort by hotkeys (one per row)"
msgstr ""

#: tfrmoptionshotkeys.lbfilter.caption
msgctxt "TFRMOPTIONSHOTKEYS.LBFILTER.CAPTION"
msgid "&Filter"
msgstr "&Filter"

#: tfrmoptionshotkeys.lblcategories.caption
msgctxt "tfrmoptionshotkeys.lblcategories.caption"
msgid "C&ategories:"
msgstr "K&ategorien:"

#: tfrmoptionshotkeys.lblcommands.caption
msgctxt "tfrmoptionshotkeys.lblcommands.caption"
msgid "Co&mmands:"
msgstr "&Befehle:"

#: tfrmoptionshotkeys.lblscfiles.caption
msgctxt "TFRMOPTIONSHOTKEYS.LBLSCFILES.CAPTION"
msgid "&Shortcut files:"
msgstr "&Verknüpfungen:"

#: tfrmoptionshotkeys.lblsortorder.caption
msgid "So&rt order:"
msgstr "So&rtierreihenfolge:"

#: tfrmoptionshotkeys.micategories.caption
msgid "Categories"
msgstr ""

#: tfrmoptionshotkeys.micommands.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.micommands.caption"
msgid "Command"
msgstr "Befehle"

#: tfrmoptionshotkeys.miseparator1.caption
#, fuzzy
msgctxt "tfrmoptionshotkeys.miseparator1.caption"
msgid "-"
msgstr "-"

#: tfrmoptionshotkeys.misortorder.caption
msgid "Sort order"
msgstr ""

#: tfrmoptionsicons.cbiconsexclude.caption
msgctxt "TFRMOPTIONSICONS.CBICONSEXCLUDE.CAPTION"
msgid "For the following &paths and their subdirectories:"
msgstr "Für die &folgenden Pfade und Unterverzeichnisse:"

#: tfrmoptionsicons.cbiconsinmenus.caption
msgid "Show icons for actions in &menus"
msgstr "Icons für Aktionen in Menüs anzeigen"

#: tfrmoptionsicons.cbiconsinmenussize.text
msgctxt "tfrmoptionsicons.cbiconsinmenussize.text"
msgid "16x16"
msgstr "16x16"

#: tfrmoptionsicons.cbiconsonbuttons.caption
msgid "Show icons on buttons"
msgstr "Icons in Buttons anzeigen"

#: tfrmoptionsicons.cbiconsshowoverlay.caption
msgctxt "TFRMOPTIONSICONS.CBICONSSHOWOVERLAY.CAPTION"
msgid "Show o&verlay icons, e.g. for links"
msgstr "&Überlagernde Icons zeigen (z. B. Pfeile bei Verknüpfungen)"

#: tfrmoptionsicons.gbdisablespecialicons.caption
msgid "Disable special icons"
msgstr "Keine speziellen Symbole"

#: tfrmoptionsicons.gbiconssize.caption
msgctxt "TFRMOPTIONSICONS.GBICONSSIZE.CAPTION"
msgid " Icon size "
msgstr "Größe der Icons"

#: tfrmoptionsicons.gbicontheme.caption
msgid "Icon theme"
msgstr "Icon Thema"

#: tfrmoptionsicons.gbshowicons.caption
msgid "Show icons"
msgstr "Icons anzeigen"

#: tfrmoptionsicons.gbshowiconsmode.caption
msgctxt "TFRMOPTIONSICONS.GBSHOWICONSMODE.CAPTION"
msgid " Show icons to the left of the filename "
msgstr "Icons links vom Dateinamen anzeigen"

#: tfrmoptionsicons.lbldiskpanel.caption
msgid "Disk panel:"
msgstr ""

#: tfrmoptionsicons.lblfilepanel.caption
msgid "File panel:"
msgstr ""

#: tfrmoptionsicons.rbiconsshowall.caption
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWALL.CAPTION"
msgid "A&ll"
msgstr "A&lle"

#: tfrmoptionsicons.rbiconsshowallandexe.caption
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWALLANDEXE.CAPTION"
msgid "All associated + &EXE/LNK (slow)"
msgstr "Alle verknüpften .&exe / .lnk - Dateien (langsam)"

#: tfrmoptionsicons.rbiconsshownone.caption
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWNONE.CAPTION"
msgid "&No icons"
msgstr "&Keine Icons"

#: tfrmoptionsicons.rbiconsshowstandard.caption
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWSTANDARD.CAPTION"
msgid "Only &standard icons"
msgstr "Nur &Standard-Icons"

#: tfrmoptionsignorelist.btnaddsel.caption
msgctxt "TFRMOPTIONSIGNORELIST.BTNADDSEL.CAPTION"
msgid "A&dd selected names"
msgstr "&Ausgewählte Namen hinzufügen"

#: tfrmoptionsignorelist.btnaddselwithpath.caption
msgctxt "TFRMOPTIONSIGNORELIST.BTNADDSELWITHPATH.CAPTION"
msgid "Add selected names with &full path"
msgstr "Ausgewählte Namen mit &komplettem Pfad hinzufügen"

#: tfrmoptionsignorelist.btnrelativesavein.hint
msgctxt "tfrmoptionsignorelist.btnrelativesavein.hint"
msgid "Some functions to select appropriate path"
msgstr "Einige Funktionen um angemessene Pfade zu wählen"

#: tfrmoptionsignorelist.chkignoreenable.caption
msgctxt "TFRMOPTIONSIGNORELIST.CHKIGNOREENABLE.CAPTION"
msgid "&Ignore (don't show) the following files and folders:"
msgstr "&Ignoriere (zeige nicht) die folgenden Dateien und Verzeichnisse:"

#: tfrmoptionsignorelist.lblsavein.caption
msgctxt "TFRMOPTIONSIGNORELIST.LBLSAVEIN.CAPTION"
msgid "&Save in:"
msgstr "&Speichern in:"

#: tfrmoptionskeyboard.cblynxlike.caption
msgid "Le&ft, Right arrows change directory (Lynx-like movement)"
msgstr "P&feil nach links, bzw. rechts wechselt das Verzeichnis (Lynx-artiges Navigieren)"

#: tfrmoptionskeyboard.gbtyping.caption
msgid "Typing"
msgstr "Tippen"

#: tfrmoptionskeyboard.lblalt.caption
msgid "Alt+L&etters:"
msgstr "Alt+Buchstabe:"

#: tfrmoptionskeyboard.lblctrlalt.caption
msgid "Ctrl+Alt+Le&tters:"
msgstr "Strg+Alt+Buchstabe:"

#: tfrmoptionskeyboard.lblnomodifier.caption
msgid "&Letters:"
msgstr "Buchstabe:"

#: tfrmoptionslayout.cbflatdiskpanel.caption
msgctxt "tfrmoptionslayout.cbflatdiskpanel.caption"
msgid "&Flat buttons"
msgstr "&Flache Buttons"

#: tfrmoptionslayout.cbflatinterface.caption
msgid "Flat i&nterface"
msgstr "Flaches Erschei&nungsbild"

#: tfrmoptionslayout.cbflattoolbar.caption
msgid "Flat b&uttons"
msgstr "Fla&che Buttons"

#: tfrmoptionslayout.cbfreespaceind.caption
msgid "Show fr&ee space indicator on drive label"
msgstr "Z&eige den 'Freien Speicher'-Indikator über den Panels"

#: tfrmoptionslayout.cblogwindow.caption
msgid "Show lo&g window"
msgstr "Lo&g-Datei anzeigen"

#: tfrmoptionslayout.cbpanelofoperations.caption
msgctxt "TFRMOPTIONSLAYOUT.CBPANELOFOPERATIONS.CAPTION"
msgid "Show panel of operation in background"
msgstr "Zeige den ausführenden Fensterteil im Hintergrund"

#: tfrmoptionslayout.cbproginmenubar.caption
msgctxt "TFRMOPTIONSLAYOUT.CBPROGINMENUBAR.CAPTION"
msgid "Show common progress in menu bar"
msgstr "Zeige allgemeinen Fortschritt in der Menü-Zeile"

#: tfrmoptionslayout.cbshowcmdline.caption
msgid "Show command l&ine"
msgstr "Befehlsze&ile anzeigen"

#: tfrmoptionslayout.cbshowcurdir.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWCURDIR.CAPTION"
msgid "Show current director&y"
msgstr "&Zeige aktuelles Verzeichnis"

#: tfrmoptionslayout.cbshowdiskpanel.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWDISKPANEL.CAPTION"
msgid "Show &drive buttons"
msgstr "Zeige Buttons für &Laufwerke"

#: tfrmoptionslayout.cbshowdrivefreespace.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWDRIVEFREESPACE.CAPTION"
msgid "Show free s&pace label"
msgstr "Zeige '&freien Speicher' von 'Gesamt-Speicherplatz' über den Panels"

#: tfrmoptionslayout.cbshowdriveslistbutton.caption
msgid "Show drives list bu&tton"
msgstr "Zeige Button für das Laufwe&rks-Drop-down-Menü"

#: tfrmoptionslayout.cbshowkeyspanel.caption
msgid "Show function &key buttons"
msgstr "Ze&ige Buttons der Funktionstasten"

#: tfrmoptionslayout.cbshowmainmenu.caption
msgid "Show &main menu"
msgstr "Zeige Haupt&menü"

#: tfrmoptionslayout.cbshowmaintoolbar.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWMAINTOOLBAR.CAPTION"
msgid "Show tool&bar"
msgstr "Zeige Tool&bar"

#: tfrmoptionslayout.cbshowshortdrivefreespace.caption
msgid "Show short free space &label"
msgstr "Zeige kurze Information zum freien Speicherp&latz"

#: tfrmoptionslayout.cbshowstatusbar.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWSTATUSBAR.CAPTION"
msgid "Show &status bar"
msgstr "&Statusleiste zeigen"

#: tfrmoptionslayout.cbshowtabheader.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWTABHEADER.CAPTION"
msgid "S&how tabstop header"
msgstr "Zeige Ta&bstop-Zeile"

#: tfrmoptionslayout.cbshowtabs.caption
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWTABS.CAPTION"
msgid "Sho&w folder tabs"
msgstr "Zeige &Verzeichnis-Tabs"

#: tfrmoptionslayout.cbtermwindow.caption
msgctxt "TFRMOPTIONSLAYOUT.CBTERMWINDOW.CAPTION"
msgid "Show te&rminal window"
msgstr "Konsolenfenste&r zeigen"

#: tfrmoptionslayout.cbtwodiskpanels.caption
msgctxt "TFRMOPTIONSLAYOUT.CBTWODISKPANELS.CAPTION"
msgid "Show two drive button bars (fi&xed width, above file windows)"
msgstr "Zeige zwei &Laufwerksleisten (feste Breite, über den Dateifenstern)"

#: tfrmoptionslayout.gbscreenlayout.caption
msgctxt "TFRMOPTIONSLAYOUT.GBSCREENLAYOUT.CAPTION"
msgid " Screen layout "
msgstr "Bildschirmdarstellung"

#: tfrmoptionslog.btnrelativelogfile.hint
msgctxt "tfrmoptionslog.btnrelativelogfile.hint"
msgid "Some functions to select appropriate path"
msgstr "Einige Funktionen um angemessene Pfade zu wählen"

#: tfrmoptionslog.btnviewlogfile.hint
msgctxt "tfrmoptionslog.btnviewlogfile.hint"
msgid "View log file content"
msgstr "Inhalt der Log-Datei betrachten"

#: tfrmoptionslog.cbincludedateinlogfilename.caption
msgid "Include date in log filename"
msgstr "Datum in den Namen der Log-Datei aufnehmen"

#: tfrmoptionslog.cblogarcop.caption
msgctxt "TFRMOPTIONSLOG.CBLOGARCOP.CAPTION"
msgid "&Pack/Unpack"
msgstr "&Packen / Entpacken"

#: tfrmoptionslog.cblogcommandlineexecution.caption
msgid "External command line execution"
msgstr "Externe Befehlszeile ausführen"

#: tfrmoptionslog.cblogcpmvln.caption
msgctxt "TFRMOPTIONSLOG.CBLOGCPMVLN.CAPTION"
msgid "Cop&y/Move/Create link/symlink"
msgstr "Kopiere/Verschiebe/Erstelle Link/s&ymb. Link"

#: tfrmoptionslog.cblogdelete.caption
msgctxt "TFRMOPTIONSLOG.CBLOGDELETE.CAPTION"
msgid "&Delete"
msgstr "&Löschen"

#: tfrmoptionslog.cblogdirop.caption
msgctxt "TFRMOPTIONSLOG.CBLOGDIROP.CAPTION"
msgid "Crea&te/Delete directories"
msgstr "Ers&telle / Lösche Verzeichnisse"

#: tfrmoptionslog.cblogerrors.caption
msgctxt "TFRMOPTIONSLOG.CBLOGERRORS.CAPTION"
msgid "Log &errors"
msgstr "F&ehler aufzeichnen"

#: tfrmoptionslog.cblogfile.caption
msgctxt "TFRMOPTIONSLOG.CBLOGFILE.CAPTION"
msgid "C&reate a log file:"
msgstr "E&rstelle Log-Datei:"

#: tfrmoptionslog.cbloginfo.caption
msgctxt "TFRMOPTIONSLOG.CBLOGINFO.CAPTION"
msgid "Log &information messages"
msgstr "Informat&ionsmeldungen aufzeichnen"

#: tfrmoptionslog.cblogstartshutdown.caption
msgid "Start/shutdown"
msgstr "Start/Beenden"

#: tfrmoptionslog.cblogsuccess.caption
msgctxt "TFRMOPTIONSLOG.CBLOGSUCCESS.CAPTION"
msgid "Log &successful operations"
msgstr "Erfolgreiche Vorg&änge aufzeichnen"

#: tfrmoptionslog.cblogvfs.caption
msgctxt "TFRMOPTIONSLOG.CBLOGVFS.CAPTION"
msgid "&File system plugins"
msgstr "&Dateisystem Plugins"

#: tfrmoptionslog.gblogfile.caption
msgctxt "TFRMOPTIONSLOG.GBLOGFILE.CAPTION"
msgid "File operation log file"
msgstr "Dateioperation Log-Datei"

#: tfrmoptionslog.gblogfileop.caption
msgid "Log operations"
msgstr "Operationen aufzeichnen:"

#: tfrmoptionslog.gblogfilestatus.caption
msgid "Operation status"
msgstr "Fortschritt des Vorgangs"

#: tfrmoptionsmisc.btnoutputpathfortoolbar.caption
msgctxt "tfrmoptionsmisc.btnoutputpathfortoolbar.caption"
msgid ">>"
msgstr ">>"

#: tfrmoptionsmisc.btnrelativeoutputpathfortoolbar.hint
msgctxt "tfrmoptionsmisc.btnrelativeoutputpathfortoolbar.hint"
msgid "Some functions to select appropriate path"
msgstr "Einige Funktionen um angemessene Pfade zu wählen"

#: tfrmoptionsmisc.btnrelativetcconfigfile.hint
msgctxt "tfrmoptionsmisc.btnrelativetcconfigfile.hint"
msgid "Some functions to select appropriate path"
msgstr "Einige Funktionen um angemessene Pfade zu wählen"

#: tfrmoptionsmisc.btnrelativetcexecutablefile.hint
msgctxt "tfrmoptionsmisc.btnrelativetcexecutablefile.hint"
msgid "Some functions to select appropriate path"
msgstr "Einige Funktionen um angemessene Pfade zu wählen"

#: tfrmoptionsmisc.btnthumbcompactcache.caption
msgid "&Remove thumbnails for no longer existing files"
msgstr "Vo&rschaubilder für gelöschte Dateien entfernen"

#: tfrmoptionsmisc.btnviewconfigfile.hint
msgctxt "tfrmoptionsmisc.btnviewconfigfile.hint"
msgid "View log file content"
msgstr "Inhalt der Log-Datei betrachten"

#: tfrmoptionsmisc.chkdesccreateunicode.caption
msgid "Create new with the encoding:"
msgstr ""

#: tfrmoptionsmisc.chkgotoroot.caption
msgid "Always &go to the root of a drive when changing drives"
msgstr "Beim Wechsel des Laufwerkes immer zur &obersten Ebenen des Laufwerkes wechseln"

#: tfrmoptionsmisc.chkshowwarningmessages.caption
msgid "Show &warning messages (\"OK\" button only)"
msgstr "&Warnungen anzeigen (nur \"OK\" Button)"

#: tfrmoptionsmisc.chkthumbsave.caption
msgid "&Save thumbnails in cache"
msgstr "&Speichern von Bildvorschauen im Cache"

#: tfrmoptionsmisc.dblthumbnails.caption
msgctxt "tfrmoptionsmisc.dblthumbnails.caption"
msgid "Thumbnails"
msgstr "Vorschaubilder"

#: tfrmoptionsmisc.gbfilecomments.caption
msgid "File comments (descript.ion)"
msgstr ""

#: tfrmoptionsmisc.gbtcexportimport.caption
msgid "Regarding TC export/import:"
msgstr "In Bezug auf TC Import/Export:"

#: tfrmoptionsmisc.lbldescrdefaultencoding.caption
msgid "Default encoding:"
msgstr ""

#: tfrmoptionsmisc.lbltcconfig.caption
msgid "Configuration file:"
msgstr "Konfigurationsdatei:"

#: tfrmoptionsmisc.lbltcexecutable.caption
msgid "TC executable:"
msgstr "TC.exe-Datei"

#: tfrmoptionsmisc.lbltcpathfortool.caption
msgid "Toolbar output path:"
msgstr "Ausgabepfad für Toolbar:"

#: tfrmoptionsmisc.lblthumbpixels.caption
msgid "pixels"
msgstr "Pixel"

#: tfrmoptionsmisc.lblthumbseparator.caption
msgctxt "tfrmoptionsmisc.lblthumbseparator.caption"
msgid "X"
msgstr "X"

#: tfrmoptionsmisc.lblthumbsize.caption
msgid "&Thumbnail size:"
msgstr "&Größe der Vorschaubilder"

#: tfrmoptionsmouse.cbselectionbymouse.caption
msgid "&Selection by mouse"
msgstr "Au&swahl mit der Maus"

#: tfrmoptionsmouse.gbscrolling.caption
msgid "Scrolling"
msgstr "Maus-Rad: Bewegen durch die Seite"

#: tfrmoptionsmouse.gbselection.caption
msgid "Selection"
msgstr "Auswahl"

#: tfrmoptionsmouse.lblmousemode.caption
msgid "&Mode:"
msgstr "&Modus"

#: tfrmoptionsmouse.rbscrolllinebyline.caption
msgid "&Line by line"
msgstr "Anzahl Zei&len"

#: tfrmoptionsmouse.rbscrolllinebylinecursor.caption
msgid "Line by line &with cursor movement"
msgstr "Zeile für Zeile mit Be&wegen der Zeilenmarkierung"

#: tfrmoptionsmouse.rbscrollpagebypage.caption
msgid "&Page by page"
msgstr "&Seite für Seite"

#: tfrmoptionsplugins.btnaddplugin.caption
msgctxt "TFRMOPTIONSPLUGINS.BTNADDPLUGIN.CAPTION"
msgid "A&dd"
msgstr "&Hinzufügen"

#: tfrmoptionsplugins.btnconfigplugin.caption
msgctxt "TFRMOPTIONSPLUGINS.BTNCONFIGPLUGIN.CAPTION"
msgid "Con&figure"
msgstr "E&instellen"

#: tfrmoptionsplugins.btnenableplugin.caption
msgctxt "TFRMOPTIONSPLUGINS.BTNENABLEPLUGIN.CAPTION"
msgid "E&nable"
msgstr "Aktiviere&n"

#: tfrmoptionsplugins.btnremoveplugin.caption
msgctxt "TFRMOPTIONSPLUGINS.BTNREMOVEPLUGIN.CAPTION"
msgid "&Remove"
msgstr "Entfe&rnen"

#: tfrmoptionsplugins.btntweakplugin.caption
msgctxt "TFRMOPTIONSPLUGINS.BTNTWEAKPLUGIN.CAPTION"
msgid "&Tweak"
msgstr "An&passen"

#: tfrmoptionsplugins.lbldsxdescription.caption
msgid "Searc&h plugins allow one to use alternative search algorithms or external tools (like \"locate\", etc.)"
msgstr "Suc&h-Plugins erlauben es, alternative Such-Algorithmen oder aber externe Tools (wie \"locate\", oder ähnliches) zu nutzen"

#: tfrmoptionsplugins.lblwcxdescription.caption
msgid "Pack&er plugins are used to work with archives"
msgstr "Pack&er-PlugIns werden benutzt um mit Archiven zu arbeiten."

#: tfrmoptionsplugins.lblwdxdescription.caption
#, fuzzy
#| msgid "Content plu&gins allow to display extended file details like mp3 tags or image attributes in file lists, or use them in search and multi-rename tool"
msgctxt "TFRMOPTIONSPLUGINS.LBLWDXDESCRIPTION.CAPTION"
msgid "Content plu&gins allow one to display extended file details like mp3 tags or image attributes in file lists, or use them in search and multi-rename tool"
msgstr "Inhalt-Plu&gins erlauben es, weitere Details (wie z.B. MP3-Tags) in Dateilisten anzuzeigen, oder sie zur Suche oder Umbenennung zu nutzen"

#: tfrmoptionsplugins.lblwfxdescription.caption
msgctxt "TFRMOPTIONSPLUGINS.LBLWFXDESCRIPTION.CAPTION"
msgid "Fi&le system plugins allow access to disks inaccessible by operating system or to external devices like Palm/PocketPC."
msgstr "Dateisystem-P&lugins erlauben auf Dateisysteme oder externe Laufwerke zuzugreifen, auf die das Betriebssystem nicht zugreifen kann (z.B. Palm oder Pocket-PCs)."

#: tfrmoptionsplugins.lblwlxdescription.caption
#, fuzzy
#| msgid "Vie&wer plugins allow to display file formats like images, spreadsheets, databases etc. in Viewer (F3, Ctrl+Q)"
msgctxt "TFRMOPTIONSPLUGINS.LBLWLXDESCRIPTION.CAPTION"
msgid "Vie&wer plugins allow one to display file formats like images, spreadsheets, databases etc. in Viewer (F3, Ctrl+Q)"
msgstr "Be&trachter-Plugins erlauben die Anzeige von Bilder, Tabellen, Datenbanken o.ä. mit dem Betrachter (F3 oder Strg+Q)."

#: tfrmoptionsplugins.stgplugins.columns[0].title.caption
msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[0].TITLE.CAPTION"
msgid "Active"
msgstr "Aktiv"

#: tfrmoptionsplugins.stgplugins.columns[1].title.caption
msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[1].TITLE.CAPTION"
msgid "Plugin"
msgstr "Plugin"

#: tfrmoptionsplugins.stgplugins.columns[2].title.caption
msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[2].TITLE.CAPTION"
msgid "Registered for"
msgstr "Registriert für"

#: tfrmoptionsplugins.stgplugins.columns[3].title.caption
msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[3].TITLE.CAPTION"
msgid "File name"
msgstr "Dateiname"

#: tfrmoptionsplugins.tsdsx.caption
msgid "&Search plugins (.DSX)"
msgstr "&Such-Plugins (.DSX)"

#: tfrmoptionsplugins.tswcx.caption
msgid "Pac&ker plugins (.WCX)"
msgstr "Pac&ker-Plugins (.WCX)"

#: tfrmoptionsplugins.tswdx.caption
msgid "Content pl&ugins (.WDX)"
msgstr "Inhalt-Pl&ugin (.WDX)"

#: tfrmoptionsplugins.tswfx.caption
msgid "F&ile system plugins (.WFX)"
msgstr "Date&isystem-Plugins (.WFX)"

#: tfrmoptionsplugins.tswlx.caption
msgid "&Viewer plugins (.WLX)"
msgstr "&Betrachter-PlugIns"

#: tfrmoptionsquicksearchfilter.cbexactbeginning.caption
msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CBEXACTBEGINNING.CAPTION"
msgid "&Beginning (name must start with first typed character)"
msgstr "&Beginn (Name soll mit dem ersten eingetippten Buchstaben beginnen)"

#: tfrmoptionsquicksearchfilter.cbexactending.caption
msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CBEXACTENDING.CAPTION"
msgid "En&ding (last character before a typed dot . must match)"
msgstr "Ende des Namens (letztes Zeichen vor einem . soll passen)"

#: tfrmoptionsquicksearchfilter.cgpoptions.caption
msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CGPOPTIONS.CAPTION"
msgid "Options"
msgstr "Optionen"

#: tfrmoptionsquicksearchfilter.gbexactnamematch.caption
msgid "Exact name match"
msgstr "Exakte Übereinstimmung des &Names"

#: tfrmoptionsquicksearchfilter.rgpsearchcase.caption
msgid "Search case"
msgstr "Suche Schreibweise"

#: tfrmoptionsquicksearchfilter.rgpsearchitems.caption
msgid "Search for these items"
msgstr "Suche nach diesen Einträgen"

#: tfrmoptionstabs.cbkeeprenamednamebacktonormal.caption
msgid "Keep renamed name when unlocking a tab"
msgstr "Umbennung erhalten, wenn ein Tab entsperrt wird"

#: tfrmoptionstabs.cbtabsactivateonclick.caption
msgctxt "TFRMOPTIONSTABS.CBTABSACTIVATEONCLICK.CAPTION"
msgid "Activate target &panel when clicking on one of its Tabs"
msgstr "Ziel-&Panel auswählen, wenn eines seiner Tabs angeklickt wird"

#: tfrmoptionstabs.cbtabsalwaysvisible.caption
msgctxt "TFRMOPTIONSTABS.CBTABSALWAYSVISIBLE.CAPTION"
msgid "&Show tab header also when there is only one tab"
msgstr "&Tab-Titel auch zeigen wenn nur einer vorhanden"

#: tfrmoptionstabs.cbtabscloseduplicatewhenclosing.caption
msgid "Close duplicate tabs when closing application"
msgstr "Doppelte Tabs schließen wenn DC geschlossen wird"

#: tfrmoptionstabs.cbtabsconfirmcloseall.caption
msgctxt "TFRMOPTIONSTABS.CBTABSCONFIRMCLOSEALL.CAPTION"
msgid "Con&firm close all tabs"
msgstr "&Schließen aller Tabs bestätigen"

#: tfrmoptionstabs.cbtabsconfirmcloselocked.caption
msgid "Confirm close locked tabs"
msgstr "Schließen von gesperrten Tabs bestätigen"

#: tfrmoptionstabs.cbtabslimitoption.caption
msgctxt "TFRMOPTIONSTABS.CBTABSLIMITOPTION.CAPTION"
msgid "&Limit tab title length to"
msgstr "Begrenze Tab-Tite&lzeile auf"

#: tfrmoptionstabs.cbtabslockedasterisk.caption
msgctxt "TFRMOPTIONSTABS.CBTABSLOCKEDASTERISK.CAPTION"
msgid "Show locked tabs &with an asterisk *"
msgstr "Alle gesperrten Tabs mit Stern * markieren"

#: tfrmoptionstabs.cbtabsmultilines.caption
msgctxt "TFRMOPTIONSTABS.CBTABSMULTILINES.CAPTION"
msgid "&Tabs on multiple lines"
msgstr "Rei&ter-Titel auf mehrere Zeilen verteilen"

#: tfrmoptionstabs.cbtabsopenforeground.caption
msgctxt "TFRMOPTIONSTABS.CBTABSOPENFOREGROUND.CAPTION"
msgid "Ctrl+&Up opens new tab in foreground"
msgstr "Strg+Pf&eil hoch öffnet einen neuen Tab im Vordergrund"

#: tfrmoptionstabs.cbtabsopennearcurrent.caption
msgctxt "TFRMOPTIONSTABS.CBTABSOPENNEARCURRENT.CAPTION"
msgid "Open &new tabs near current tab"
msgstr "&Neuen Tab neben aktuellem Tab einfügen"

#: tfrmoptionstabs.cbtabsreusetabwhenpossible.caption
msgid "Reuse existing tab when possible"
msgstr "Bestehenden Tab erneut nutze, wenn möglich"

#: tfrmoptionstabs.cbtabsshowclosebutton.caption
msgctxt "TFRMOPTIONSTABS.CBTABSSHOWCLOSEBUTTON.CAPTION"
msgid "Show ta&b close button"
msgstr "Zeige Button um Ta&bs zu schließen"

#: tfrmoptionstabs.cbtabsshowdriveletter.caption
msgid "Always show drive letter in tab title"
msgstr "Laufwerksbuchstaben im Tab-Titel immer zeigen"

#: tfrmoptionstabs.gbtabs.caption
msgctxt "TFRMOPTIONSTABS.GBTABS.CAPTION"
msgid "Folder tabs headers"
msgstr "Verzeichnis-Tab-Titel"

#: tfrmoptionstabs.lblchar.caption
msgctxt "TFRMOPTIONSTABS.LBLCHAR.CAPTION"
msgid "characters"
msgstr "Bu&chstaben"

#: tfrmoptionstabs.lbltabsactionondoubleclick.caption
msgid "Action to do when double click on a tab:"
msgstr "Aktion festlegen, wenn auf den Tab-Titel doppel-geklickt wird"

#: tfrmoptionstabs.lbltabsposition.caption
msgctxt "TFRMOPTIONSTABS.LBLTABSPOSITION.CAPTION"
msgid "Ta&bs position"
msgstr "Rei&ter-Position"

#: tfrmoptionstabsextra.cbdefaultexistingtabstokeep.text
msgctxt "tfrmoptionstabsextra.cbdefaultexistingtabstokeep.text"
msgid "None"
msgstr "Nichts"

#: tfrmoptionstabsextra.cbdefaultsavedirhistory.text
msgctxt "tfrmoptionstabsextra.cbdefaultsavedirhistory.text"
msgid "No"
msgstr "Nein"

#: tfrmoptionstabsextra.cbdefaulttargetpanelleftsaved.text
msgctxt "tfrmoptionstabsextra.cbdefaulttargetpanelleftsaved.text"
msgid "Left"
msgstr "Links"

#: tfrmoptionstabsextra.cbdefaulttargetpanelrightsaved.text
msgctxt "tfrmoptionstabsextra.cbdefaulttargetpanelrightsaved.text"
msgid "Right"
msgstr "Rechts"

#: tfrmoptionstabsextra.cbgotoconfigafterresave.caption
msgid "Goto to Favorite Tabs Configuration after resaving"
msgstr "Nach dem erneuten Speichern zur-Tab-Konfiguration wechseln"

#: tfrmoptionstabsextra.cbgotoconfigaftersave.caption
msgid "Goto to Favorite Tabs Configuration after saving a new one"
msgstr "Nach dem Speichern eines neuen Tab zur-Tab-Konfiguration wechseln"

#: tfrmoptionstabsextra.cbusefavoritetabsextraoptions.caption
msgid "Enable Favorite Tabs extra options (select target side when restore, etc.)"
msgstr "Extra-Optionen für Favoriten-Tabs ermöglichen (Zielseite beim Wiederherstellen auswählen, etc.)"

#: tfrmoptionstabsextra.gbdefaulttabsavedrestoration.caption
msgid "Default extra settings when saving new Favorite Tabs:"
msgstr "Standard-Extra-Einstellungen zum Speichern neuer Favoriten-Tabs:"

#: tfrmoptionstabsextra.gbtabs.caption
msgid "Folder tabs headers extra"
msgstr "Extras für Tabs-Header"

#: tfrmoptionstabsextra.lbldefaultexistingtabstokeep.caption
msgid "When restoring tab, existing tabs to keep:"
msgstr "Wenn Tabs wiederhergestellt werden, diese erhalten:"

#: tfrmoptionstabsextra.lbldefaulttargetpanelleftsaved.caption
msgid "Tabs saved on left will be restored to:"
msgstr "Links gespeicherte Tabs sollen hier wiederhergestellt werden:"

#: tfrmoptionstabsextra.lbldefaulttargetpanelrightsaved.caption
msgid "Tabs saved on right will be restored to:"
msgstr "Rechts gespeicherte Tabs sollen hier wiederhergestellt werden:"

#: tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption
msgctxt "tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption"
msgid "Keep saving dir history with Favorite Tabs:"
msgstr "Verzeichnis-Verlauf weiter speichern bei diesen Favoriten-Tabs:"

#: tfrmoptionstabsextra.rgwheretoadd.caption
msgid "Default position in menu when saving a new Favorite Tabs:"
msgstr "Standardposition im Menü beim Speicherneines neuen Favoriten-Tabs:"

#: tfrmoptionsterminal.edrunintermcloseparams.hint
#, fuzzy
msgctxt "tfrmoptionsterminal.edrunintermcloseparams.hint"
msgid "{command} should normally be present here to reflect the command to be run in terminal"
msgstr "{Befehl} sollte normalerweise hier angezeigt werden um den Befehl im Terminal auszuführen"

#: tfrmoptionsterminal.edrunintermstayopenparams.hint
#, fuzzy
msgctxt "tfrmoptionsterminal.edrunintermstayopenparams.hint"
msgid "{command} should normally be present here to reflect the command to be run in terminal"
msgstr "{Befehl} sollte normalerweise hier angezeigt werden um den Befehl im Terminal auszuführen"

#: tfrmoptionsterminal.edruntermparams.hint
#, fuzzy
msgctxt "tfrmoptionsterminal.edruntermparams.hint"
msgid "{command} should normally be present here to reflect the command to be run in terminal"
msgstr "{Befehl} sollte normalerweise hier angezeigt werden um den Befehl im Terminal auszuführen"

#: tfrmoptionsterminal.gbjustrunterminal.caption
msgid "Command for just running terminal:"
msgstr "Befehl, um ein Terminal zu öffnen:"

#: tfrmoptionsterminal.gbruninterminalclose.caption
msgid "Command for running a command in terminal and close after:"
msgstr "Befehl, um einen Befehl im Terminal auszuführen und es anschließend zu schließen:"

#: tfrmoptionsterminal.gbruninterminalstayopen.caption
msgid "Command for running a command in terminal and stay open:"
msgstr "Befehl, um einen Befehl im Terminal auszuführen und es anschließend offen zu halten:"

#: tfrmoptionsterminal.lbrunintermclosecmd.caption
msgctxt "tfrmoptionsterminal.lbrunintermclosecmd.caption"
msgid "Command:"
msgstr "Befehl"

#: tfrmoptionsterminal.lbrunintermcloseparams.caption
msgctxt "tfrmoptionsterminal.lbrunintermcloseparams.caption"
msgid "Parameters:"
msgstr "Parameter"

#: tfrmoptionsterminal.lbrunintermstayopencmd.caption
msgctxt "tfrmoptionsterminal.lbrunintermstayopencmd.caption"
msgid "Command:"
msgstr "Befehl"

#: tfrmoptionsterminal.lbrunintermstayopenparams.caption
msgctxt "tfrmoptionsterminal.lbrunintermstayopenparams.caption"
msgid "Parameters:"
msgstr "Parameter"

#: tfrmoptionsterminal.lbruntermcmd.caption
msgctxt "tfrmoptionsterminal.lbruntermcmd.caption"
msgid "Command:"
msgstr "Befehl"

#: tfrmoptionsterminal.lbruntermparams.caption
msgctxt "tfrmoptionsterminal.lbruntermparams.caption"
msgid "Parameters:"
msgstr "Parameter"

#: tfrmoptionstoolbar.btnclonebutton.caption
msgid "C&lone button"
msgstr "S&Button klonen"

#: tfrmoptionstoolbar.btndeletebutton.caption
msgctxt "tfrmoptionstoolbar.btndeletebutton.caption"
msgid "&Delete"
msgstr "L&öschen"

#: tfrmoptionstoolbar.btnedithotkey.caption
msgid "Edit hot&key"
msgstr "Tastatur&kürzel bearbeiten"

#: tfrmoptionstoolbar.btninsertbutton.caption
msgid "&Insert new button"
msgstr "Neuen Button e&infügen"

#: tfrmoptionstoolbar.btnopencmddlg.caption
msgid "Select"
msgstr "Auswählen"

#: tfrmoptionstoolbar.btnopenfile.caption
msgctxt "tfrmoptionstoolbar.btnopenfile.caption"
msgid ">>"
msgstr ">>"

#: tfrmoptionstoolbar.btnother.caption
msgctxt "tfrmoptionstoolbar.btnother.caption"
msgid "Other..."
msgstr "Andere..."

#: tfrmoptionstoolbar.btnremovehotkey.caption
msgctxt "tfrmoptionstoolbar.btnremovehotkey.caption"
msgid "Remove hotke&y"
msgstr "Tastaturk&ürzel entfernen"

#: tfrmoptionstoolbar.btnstartpath.caption
msgctxt "tfrmoptionstoolbar.btnstartpath.caption"
msgid ">>"
msgstr ">>"

#: tfrmoptionstoolbar.btnsuggestiontooltip.caption
msgid "Suggest"
msgstr "Vorschlag"

#: tfrmoptionstoolbar.btnsuggestiontooltip.hint
msgid "Have DC suggest the tooltip based on button type, command and parameters"
msgstr "DC einen Vorschlag für den Tooltip anhand des Buttons, Befehls oder Parameters machen lassen"

#: tfrmoptionstoolbar.cbflatbuttons.caption
msgctxt "tfrmoptionstoolbar.cbflatbuttons.caption"
msgid "&Flat buttons"
msgstr "&Flache Buttons"

#: tfrmoptionstoolbar.cbreporterrorwithcommands.caption
msgid "Report errors with commands"
msgstr "Berichte Fehler mit Befehlen"

#: tfrmoptionstoolbar.edtinternalparameters.hint
msgid "Enter command parameters, each in a separate line. Press F1 to see help on parameters."
msgstr "Befehlsparameter eingeben, jeden in einer eigenen Zeile. [F1] drücken um Hilfe zu Parametern zu erhalten."

#: tfrmoptionstoolbar.gbgroupbox.caption
msgctxt "tfrmoptionstoolbar.gbgroupbox.caption"
msgid "Appearance"
msgstr "Aussehen"

#: tfrmoptionstoolbar.lblbarsize.caption
msgid "&Bar size:"
msgstr "Höhe de&r Leiste:"

#: tfrmoptionstoolbar.lblexternalcommand.caption
msgid "Comman&d:"
msgstr "&Befehl:"

#: tfrmoptionstoolbar.lblexternalparameters.caption
msgctxt "tfrmoptionstoolbar.lblexternalparameters.caption"
msgid "Parameter&s:"
msgstr "&Parameter:"

#: tfrmoptionstoolbar.lblhelponinternalcommand.caption
msgctxt "tfrmoptionstoolbar.lblhelponinternalcommand.caption"
msgid "Help"
msgstr "Hilfe"

#: tfrmoptionstoolbar.lblhotkey.caption
msgid "Hot key:"
msgstr "Tastaturkürzel:"

#: tfrmoptionstoolbar.lbliconfile.caption
msgctxt "tfrmoptionstoolbar.lbliconfile.caption"
msgid "Ico&n:"
msgstr "Ico&n:"

#: tfrmoptionstoolbar.lbliconsize.caption
msgid "Icon si&ze:"
msgstr "Größe der I&cons:"

#: tfrmoptionstoolbar.lblinternalcommand.caption
msgctxt "tfrmoptionstoolbar.lblinternalcommand.caption"
msgid "Co&mmand:"
msgstr "&Befehl:"

#: tfrmoptionstoolbar.lblinternalparameters.caption
msgctxt "tfrmoptionstoolbar.lblinternalparameters.caption"
msgid "&Parameters:"
msgstr "&Parameter:"

#: tfrmoptionstoolbar.lblstartpath.caption
msgctxt "tfrmoptionstoolbar.lblstartpath.caption"
msgid "Start pat&h:"
msgstr "Start&pfad"

#: tfrmoptionstoolbar.lbltooltip.caption
msgid "&Tooltip:"
msgstr "&Tooltip:"

#: tfrmoptionstoolbar.miaddallcmds.caption
msgid "Add toolbar with ALL DC commands"
msgstr "Toolbar mit ALLEN DC-Befehlen hinzufügen"

#: tfrmoptionstoolbar.miaddexternalcommandsubmenu.caption
msgid "for an external command"
msgstr "für externen Befehl"

#: tfrmoptionstoolbar.miaddinternalcommandsubmenu.caption
msgid "for an internal command"
msgstr "für internen Befehl"

#: tfrmoptionstoolbar.miaddseparatorsubmenu.caption
msgid "for a separator"
msgstr "für ein Trennzeichen"

#: tfrmoptionstoolbar.miaddsubtoolbarsubmenu.caption
msgid "for a sub-tool bar"
msgstr "für ein Untermenü"

#: tfrmoptionstoolbar.mibackup.caption
msgctxt "tfrmoptionstoolbar.mibackup.caption"
msgid "Backup..."
msgstr "Backup..."

#: tfrmoptionstoolbar.miexport.caption
msgctxt "tfrmoptionstoolbar.miexport.caption"
msgid "Export..."
msgstr "Exportieren..."

#: tfrmoptionstoolbar.miexportcurrent.caption
msgid "Current toolbar..."
msgstr "Aktuelle Toolbar..."

#: tfrmoptionstoolbar.miexportcurrenttodcbar.caption
msgctxt "tfrmoptionstoolbar.miexportcurrenttodcbar.caption"
msgid "to a Toolbar File (.toolbar)"
msgstr "in eine Toolbar-Datei"

#: tfrmoptionstoolbar.miexportcurrenttotcbarkeep.caption
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcbarkeep.caption"
msgid "to a TC .BAR file (keep existing)"
msgstr "in eine TC .bar - Datei (bestehende erhalten)"

#: tfrmoptionstoolbar.miexportcurrenttotcbarnokeep.caption
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcbarnokeep.caption"
msgid "to a TC .BAR file (erase existing)"
msgstr "in eine TC .bar - Datei (bestehende überschreiben)"

#: tfrmoptionstoolbar.miexportcurrenttotcinikeep.caption
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcinikeep.caption"
msgid "to a \"wincmd.ini\" of TC (keep existing)"
msgstr "zu einer \"wincmd.ini\" aus TotalCommander (bestehende erhalten)"

#: tfrmoptionstoolbar.miexportcurrenttotcininokeep.caption
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcininokeep.caption"
msgid "to a \"wincmd.ini\" of TC (erase existing)"
msgstr "zu einer \"wincmd.ini\" aus TotalCommander (bestehende ersetzen)"

#: tfrmoptionstoolbar.miexportseparator1.caption
msgctxt "tfrmoptionstoolbar.miexportseparator1.caption"
msgid "-"
msgstr "-"

#: tfrmoptionstoolbar.miexportseparator2.caption
msgctxt "tfrmoptionstoolbar.miexportseparator2.caption"
msgid "-"
msgstr "-"

#: tfrmoptionstoolbar.miexportseparator3.caption
msgctxt "tfrmoptionstoolbar.miexportseparator3.caption"
msgid "-"
msgstr "-"

#: tfrmoptionstoolbar.miexportseparator4.caption
msgctxt "tfrmoptionstoolbar.miexportseparator4.caption"
msgid "-"
msgstr "-"

#: tfrmoptionstoolbar.miexporttop.caption
msgid "Top toolbar..."
msgstr "Top-Toolbar..."

#: tfrmoptionstoolbar.miexporttoptobackup.caption
msgid "Save a backup of Toolbar"
msgstr "speichere ein Backup der Toolbar"

#: tfrmoptionstoolbar.miexporttoptodcbar.caption
msgctxt "tfrmoptionstoolbar.miexporttoptodcbar.caption"
msgid "to a Toolbar File (.toolbar)"
msgstr "in eine Toolbar-Datei (.toolbar)"

#: tfrmoptionstoolbar.miexporttoptotcbarkeep.caption
msgctxt "tfrmoptionstoolbar.miexporttoptotcbarkeep.caption"
msgid "to a TC .BAR file (keep existing)"
msgstr "in eine TC .bar - Datei (bestehende erhalten)"

#: tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption
msgctxt "tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption"
msgid "to a TC .BAR file (erase existing)"
msgstr "in eine TC .bar - Datei (bestehende überschreiben)"

#: tfrmoptionstoolbar.miexporttoptotcinikeep.caption
msgctxt "tfrmoptionstoolbar.miexporttoptotcinikeep.caption"
msgid "to a \"wincmd.ini\" of TC (keep existing)"
msgstr "zu einer \"wincmd.ini\" aus TotalCommander (bestehende erhalten)"

#: tfrmoptionstoolbar.miexporttoptotcininokeep.caption
msgctxt "tfrmoptionstoolbar.miexporttoptotcininokeep.caption"
msgid "to a \"wincmd.ini\" of TC (erase existing)"
msgstr "zu einer \"wincmd.ini\" aus TotalCommander (bestehende ersetzen)"

#: tfrmoptionstoolbar.miexternalcommandaftercurrent.caption
msgctxt "tfrmoptionstoolbar.miexternalcommandaftercurrent.caption"
msgid "just after current selection"
msgstr "direkt hinter der aktuellen Auswahl"

#: tfrmoptionstoolbar.miexternalcommandfirstelement.caption
msgctxt "tfrmoptionstoolbar.miexternalcommandfirstelement.caption"
msgid "as first element"
msgstr "als erstes Element"

#: tfrmoptionstoolbar.miexternalcommandlastelement.caption
msgctxt "tfrmoptionstoolbar.miexternalcommandlastelement.caption"
msgid "as last element"
msgstr "als letztes Element"

#: tfrmoptionstoolbar.miexternalcommandpriorcurrent.caption
msgctxt "tfrmoptionstoolbar.miexternalcommandpriorcurrent.caption"
msgid "just prior current selection"
msgstr "direkt vor die aktuelle Auswahl"

#: tfrmoptionstoolbar.miimport.caption
msgctxt "tfrmoptionstoolbar.miimport.caption"
msgid "Import..."
msgstr "Importieren..."

#: tfrmoptionstoolbar.miimportbackup.caption
msgid "Restore a backup of Toolbar"
msgstr "Backup einer Toolbar wieder herstellen"

#: tfrmoptionstoolbar.miimportbackupaddcurrent.caption
msgctxt "tfrmoptionstoolbar.miimportbackupaddcurrent.caption"
msgid "to add to current toolbar"
msgstr "zur aktuellen Toolbar hinzufügen"

#: tfrmoptionstoolbar.miimportbackupaddmenucurrent.caption
msgctxt "tfrmoptionstoolbar.miimportbackupaddmenucurrent.caption"
msgid "to add to a new toolbar to current toolbar"
msgstr "zu neuer Toolbar in der aktuellen Toolbar hinzufügen"

#: tfrmoptionstoolbar.miimportbackupaddmenutop.caption
msgctxt "tfrmoptionstoolbar.miimportbackupaddmenutop.caption"
msgid "to add to a new toolbar to top toolbar"
msgstr "zu einer neuen Toolbar auf oberster Toolbarebene hinzufügen"

#: tfrmoptionstoolbar.miimportbackupaddtop.caption
msgctxt "tfrmoptionstoolbar.miimportbackupaddtop.caption"
msgid "to add to top toolbar"
msgstr "zu oberster Toolbarebene hinzufügen"

#: tfrmoptionstoolbar.miimportbackupreplacetop.caption
msgctxt "tfrmoptionstoolbar.miimportbackupreplacetop.caption"
msgid "to replace top toolbar"
msgstr "die oberste Toolbarebene ersetzen"

#: tfrmoptionstoolbar.miimportdcbar.caption
msgid "from a Toolbar File (.toolbar)"
msgstr "aus einer Toolbar-Datei (.toolbar)"

#: tfrmoptionstoolbar.miimportdcbaraddcurrent.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddcurrent.caption"
msgid "to add to current toolbar"
msgstr "zu aktueller Toolbar hinzufügen"

#: tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption"
msgid "to add to a new toolbar to current toolbar"
msgstr "zu neuer Toolbar in der aktueller Toolbar hinzufügen"

#: tfrmoptionstoolbar.miimportdcbaraddmenutop.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenutop.caption"
msgid "to add to a new toolbar to top toolbar"
msgstr "zu neuer Toolbar an oberster Position der Toolbar hinzufügen"

#: tfrmoptionstoolbar.miimportdcbaraddtop.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddtop.caption"
msgid "to add to top toolbar"
msgstr "zu oberster Toolbar hinzufügen"

#: tfrmoptionstoolbar.miimportdcbarreplacetop.caption
msgctxt "tfrmoptionstoolbar.miimportdcbarreplacetop.caption"
msgid "to replace top toolbar"
msgstr "die oberste Toolbar ersetzen"

#: tfrmoptionstoolbar.miimportseparator.caption
msgctxt "tfrmoptionstoolbar.miimportseparator.caption"
msgid "-"
msgstr "-"

#: tfrmoptionstoolbar.miimporttcbar.caption
msgid "from a single TC .BAR file"
msgstr "aus einzelner TC .bar - Datei"

#: tfrmoptionstoolbar.miimporttcbaraddcurrent.caption
msgctxt "tfrmoptionstoolbar.miimporttcbaraddcurrent.caption"
msgid "to add to current toolbar"
msgstr "zu aktueller Toolbar hinzufügen"

#: tfrmoptionstoolbar.miimporttcbaraddmenucurrent.caption
msgctxt "tfrmoptionstoolbar.miimporttcbaraddmenucurrent.caption"
msgid "to add to a new toolbar to current toolbar"
msgstr "zu einer neuen Toolbar in der aktuellen Toolbar hinzufügen"

#: tfrmoptionstoolbar.miimporttcbaraddmenutop.caption
msgctxt "tfrmoptionstoolbar.miimporttcbaraddmenutop.caption"
msgid "to add to a new toolbar to top toolbar"
msgstr "zu einer neuen Toolbar der obersten Toolbar hinzufügen"

#: tfrmoptionstoolbar.miimporttcbaraddtop.caption
msgctxt "tfrmoptionstoolbar.miimporttcbaraddtop.caption"
msgid "to add to top toolbar"
msgstr "zu oberster Toolbar hinzufügen"

#: tfrmoptionstoolbar.miimporttcbarreplacetop.caption
msgctxt "tfrmoptionstoolbar.miimporttcbarreplacetop.caption"
msgid "to replace top toolbar"
msgstr "die oberste Toolbar ersetzen"

#: tfrmoptionstoolbar.miimporttcini.caption
msgid "from \"wincmd.ini\" of TC..."
msgstr "aus \"wincmd.ini\" des TC"

#: tfrmoptionstoolbar.miimporttciniaddcurrent.caption
msgctxt "tfrmoptionstoolbar.miimporttciniaddcurrent.caption"
msgid "to add to current toolbar"
msgstr "zu aktueller Toolbar hinzufügen"

#: tfrmoptionstoolbar.miimporttciniaddmenucurrent.caption
msgctxt "tfrmoptionstoolbar.miimporttciniaddmenucurrent.caption"
msgid "to add to a new toolbar to current toolbar"
msgstr "zu einer neuen Toolbar in der aktuellen Toolbar hinzufügen"

#: tfrmoptionstoolbar.miimporttciniaddmenutop.caption
msgctxt "tfrmoptionstoolbar.miimporttciniaddmenutop.caption"
msgid "to add to a new toolbar to top toolbar"
msgstr "zu einer neuen Toolbar in der obersten Toolbar hinzufügen"

#: tfrmoptionstoolbar.miimporttciniaddtop.caption
msgctxt "tfrmoptionstoolbar.miimporttciniaddtop.caption"
msgid "to add to top toolbar"
msgstr "zur obersten Toolbar hinzufügen"

#: tfrmoptionstoolbar.miimporttcinireplacetop.caption
msgctxt "tfrmoptionstoolbar.miimporttcinireplacetop.caption"
msgid "to replace top toolbar"
msgstr "die oberste Toolbar ersetzen"

#: tfrmoptionstoolbar.miinternalcommandaftercurrent.caption
msgctxt "tfrmoptionstoolbar.miinternalcommandaftercurrent.caption"
msgid "just after current selection"
msgstr "direkt hinter die aktuelle Markierung"

#: tfrmoptionstoolbar.miinternalcommandfirstelement.caption
msgctxt "tfrmoptionstoolbar.miinternalcommandfirstelement.caption"
msgid "as first element"
msgstr "als erstes Element"

#: tfrmoptionstoolbar.miinternalcommandlastelement.caption
msgctxt "tfrmoptionstoolbar.miinternalcommandlastelement.caption"
msgid "as last element"
msgstr "als letztes Element"

#: tfrmoptionstoolbar.miinternalcommandpriorcurrent.caption
msgctxt "tfrmoptionstoolbar.miinternalcommandpriorcurrent.caption"
msgid "just prior current selection"
msgstr "direkt vor die aktuelle Markierung"

#: tfrmoptionstoolbar.misearchandreplace.caption
msgctxt "tfrmoptionstoolbar.misearchandreplace.caption"
msgid "Search and replace..."
msgstr "Suchen und Ersetzen..."

#: tfrmoptionstoolbar.miseparator1.caption
msgctxt "tfrmoptionstoolbar.miseparator1.caption"
msgid "-"
msgstr "-"

#: tfrmoptionstoolbar.miseparator10.caption
msgctxt "tfrmoptionstoolbar.miseparator10.caption"
msgid "-"
msgstr "-"

#: tfrmoptionstoolbar.miseparator11.caption
msgctxt "tfrmoptionstoolbar.miseparator11.caption"
msgid "-"
msgstr "-"

#: tfrmoptionstoolbar.miseparator13.caption
msgctxt "tfrmoptionstoolbar.miseparator13.caption"
msgid "-"
msgstr "-"

#: tfrmoptionstoolbar.miseparator14.caption
msgctxt "tfrmoptionstoolbar.miseparator14.caption"
msgid "-"
msgstr "-"

#: tfrmoptionstoolbar.miseparator2.caption
msgctxt "tfrmoptionstoolbar.miseparator2.caption"
msgid "-"
msgstr "-"

#: tfrmoptionstoolbar.miseparator6.caption
msgctxt "tfrmoptionstoolbar.miseparator6.caption"
msgid "-"
msgstr "-"

#: tfrmoptionstoolbar.miseparator7.caption
msgctxt "tfrmoptionstoolbar.miseparator7.caption"
msgid "-"
msgstr "-"

#: tfrmoptionstoolbar.miseparator8.caption
msgctxt "tfrmoptionstoolbar.miseparator8.caption"
msgid "-"
msgstr "-"

#: tfrmoptionstoolbar.miseparator9.caption
msgctxt "tfrmoptionstoolbar.miseparator9.caption"
msgid "-"
msgstr "-"

#: tfrmoptionstoolbar.miseparatoraftercurrent.caption
msgctxt "tfrmoptionstoolbar.miseparatoraftercurrent.caption"
msgid "just after current selection"
msgstr "direkt hinter die aktuelle Markierung"

#: tfrmoptionstoolbar.miseparatorfirstitem.caption
msgctxt "tfrmoptionstoolbar.miseparatorfirstitem.caption"
msgid "as first element"
msgstr "als erstes Element"

#: tfrmoptionstoolbar.miseparatorlastelement.caption
msgctxt "tfrmoptionstoolbar.miseparatorlastelement.caption"
msgid "as last element"
msgstr "als letztes Element"

#: tfrmoptionstoolbar.miseparatorpriorcurrent.caption
msgctxt "tfrmoptionstoolbar.miseparatorpriorcurrent.caption"
msgid "just prior current selection"
msgstr "direkt vor die aktuelle Markierung"

#: tfrmoptionstoolbar.misrcrplallofall.caption
msgid "in all of all the above..."
msgstr "Alle in allen oberhalb..."

#: tfrmoptionstoolbar.misrcrplclickseparator.caption
msgctxt "tfrmoptionstoolbar.misrcrplclickseparator.caption"
msgid "-"
msgstr "-"

#: tfrmoptionstoolbar.misrcrplcommands.caption
msgid "in all commands..."
msgstr "in allen Befehlen..."

#: tfrmoptionstoolbar.misrcrpliconnames.caption
msgid "in all icon names..."
msgstr "in allen Icon-Bezeichnungen..."

#: tfrmoptionstoolbar.misrcrplparameters.caption
msgid "in all parameters..."
msgstr "in allen Parametern..."

#: tfrmoptionstoolbar.misrcrplstartpath.caption
msgid "in all start path..."
msgstr "in allen Startpfaden..."

#: tfrmoptionstoolbar.misubtoolbaraftercurrent.caption
msgctxt "tfrmoptionstoolbar.misubtoolbaraftercurrent.caption"
msgid "just after current selection"
msgstr "direkt hinter die aktuelle Markierung"

#: tfrmoptionstoolbar.misubtoolbarfirstelement.caption
msgctxt "tfrmoptionstoolbar.misubtoolbarfirstelement.caption"
msgid "as first element"
msgstr "als erstes Element"

#: tfrmoptionstoolbar.misubtoolbarlastelement.caption
msgctxt "tfrmoptionstoolbar.misubtoolbarlastelement.caption"
msgid "as last element"
msgstr "als letztes Element"

#: tfrmoptionstoolbar.misubtoolbarpriorcurrent.caption
msgctxt "tfrmoptionstoolbar.misubtoolbarpriorcurrent.caption"
msgid "just prior current selection"
msgstr "direkt vor die aktuelle Markierung"

#: tfrmoptionstoolbar.rgtoolitemtype.caption
msgid "Button type"
msgstr "Button-Typ"

#: tfrmoptionstoolbase.btnrelativetoolpath.hint
msgctxt "tfrmoptionstoolbase.btnrelativetoolpath.hint"
msgid "Some functions to select appropriate path"
msgstr "Einige Funktionen um angemessene Pfade zu wählen"

#: tfrmoptionstoolbase.cbtoolskeepterminalopen.caption
msgid "&Keep terminal window open after executing program"
msgstr "&Konsolenfenster offen lassen, wenn der Vorgang abgeschlossen ist"

#: tfrmoptionstoolbase.cbtoolsruninterminal.caption
msgid "&Execute in terminal"
msgstr "In Konsol&enfenster ausführen"

#: tfrmoptionstoolbase.cbtoolsuseexternalprogram.caption
msgid "&Use external program"
msgstr "Externes Programm ben&utzen"

#: tfrmoptionstoolbase.lbltoolsparameters.caption
msgid "A&dditional parameters"
msgstr "Zus&ätzliche Parameter"

#: tfrmoptionstoolbase.lbltoolspath.caption
msgid "&Path to program to execute"
msgstr "&Pfad zum ausführbaren Programm"

#: tfrmoptionstooltips.btnaddfields.caption
msgctxt "TFRMOPTIONSTOOLTIPS.BTNADDFIELDS.CAPTION"
msgid "A&dd"
msgstr "&Hinzufügen"

#: tfrmoptionstooltips.btnapplyfields.caption
msgctxt "TFRMOPTIONSTOOLTIPS.BTNAPPLYFIELDS.CAPTION"
msgid "A&pply"
msgstr "&Übernehmen"

#: tfrmoptionstooltips.btndeletefields.caption
msgctxt "TFRMOPTIONSTOOLTIPS.BTNDELETEFIELDS.CAPTION"
msgid "D&elete"
msgstr "&Löschen"

#: tfrmoptionstooltips.btnfieldslist.caption
msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSLIST.CAPTION"
msgid ">>"
msgstr ">>"

#: tfrmoptionstooltips.btnfieldssearchtemplate.hint
msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSSEARCHTEMPLATE.HINT"
msgid "Template..."
msgstr "Vorlage..."

#: tfrmoptionstooltips.chkshowtooltip.caption
msgid "&Show tooltip for files in the file panel"
msgstr "Zeige Tooltips (Hinweistexte) für Dateien im Panel"

#: tfrmoptionstooltips.gbcustomfields.caption
msgctxt "TFRMOPTIONSTOOLTIPS.GBCUSTOMFIELDS.CAPTION"
msgid "Custom fields by file type"
msgstr "Angepasste Felder nach Dateityp"

#: tfrmoptionstooltips.lblfieldslist.caption
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSLIST.CAPTION"
msgid "Category &hint:"
msgstr "Kategorie-&Hinweis:"

#: tfrmoptionstooltips.lblfieldsmask.caption
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSMASK.CAPTION"
msgid "Category &mask:"
msgstr "Kategorie&maske"

#: tfrmoptionstooltips.lblfieldsname.caption
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSNAME.CAPTION"
msgid "Category &name:"
msgstr "Kategorie&name"

#: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfromdoubleclick.caption
msgid "With double-click on the bar on top of a file panel"
msgstr ""

#: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption
msgctxt "tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption"
msgid "With the menu and internal command"
msgstr ""

#: tfrmoptionstreeviewmenu.ckbdoubleclickselect.caption
msgid "Double click in tree select and exit"
msgstr ""

#: tfrmoptionstreeviewmenu.ckbfavoritatabsfrommenucommand.caption
msgctxt "tfrmoptionstreeviewmenu.ckbfavoritatabsfrommenucommand.caption"
msgid "With the menu and internal command"
msgstr ""

#: tfrmoptionstreeviewmenu.ckbfavoritetabsfromdoubleclick.caption
msgid "With double-click on a tab (if configured for it)"
msgstr ""

#: tfrmoptionstreeviewmenu.ckbshortcutselectandclose.caption
msgid "When using the keyboard shortcut, it will exit the window returning the current choice"
msgstr ""

#: tfrmoptionstreeviewmenu.ckbsingleclickselect.caption
msgid "Single mouse click in tree select and exit"
msgstr ""

#: tfrmoptionstreeviewmenu.ckbuseforcommandlinehistory.caption
msgid "Use it for Command Line History"
msgstr ""

#: tfrmoptionstreeviewmenu.ckbusefordirhistory.caption
msgid "Use it for the Dir History"
msgstr ""

#: tfrmoptionstreeviewmenu.ckbuseforviewhistory.caption
msgid "Use it for the View History (Visited paths for active view)"
msgstr ""

#: tfrmoptionstreeviewmenu.gbbehavior.caption
msgid "Behavior regarding selection:"
msgstr ""

#: tfrmoptionstreeviewmenu.gbtreeviewmenusettings.caption
msgid "Tree View Menus related options:"
msgstr ""

#: tfrmoptionstreeviewmenu.gbwheretousetreeviewmenu.caption
msgid "Where to use Tree View Menus:"
msgstr ""

#: tfrmoptionstreeviewmenu.lblnote.caption
msgid "*NOTE: Regarding the options like the case sensitivity, ignoring accents or not, these are saved and restored individually for each context from a usage and session to another."
msgstr ""

#: tfrmoptionstreeviewmenu.lbluseindirectoryhotlist.caption
msgid "With Directory Hotlist:"
msgstr ""

#: tfrmoptionstreeviewmenu.lblusewithfavoritetabs.caption
msgid "With Favorite Tabs:"
msgstr ""

#: tfrmoptionstreeviewmenu.lblusewithhistory.caption
msgid "With History:"
msgstr ""

#: tfrmoptionstreeviewmenucolor.btnbackgroundcolor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btnbackgroundcolor.caption"
msgid ">>"
msgstr ">>"

#: tfrmoptionstreeviewmenucolor.btncursorcolor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btncursorcolor.caption"
msgid ">>"
msgstr ">>"

#: tfrmoptionstreeviewmenucolor.btnfoundtextcolor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btnfoundtextcolor.caption"
msgid ">>"
msgstr ">>"

#: tfrmoptionstreeviewmenucolor.btnfoundtextundercursor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btnfoundtextundercursor.caption"
msgid ">>"
msgstr ">>"

#: tfrmoptionstreeviewmenucolor.btnnormaltextcolor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btnnormaltextcolor.caption"
msgid ">>"
msgstr ">>"

#: tfrmoptionstreeviewmenucolor.btnnormaltextundercursor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btnnormaltextundercursor.caption"
msgid ">>"
msgstr ">>"

#: tfrmoptionstreeviewmenucolor.btnsecondarytextcolor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btnsecondarytextcolor.caption"
msgid ">>"
msgstr ">>"

#: tfrmoptionstreeviewmenucolor.btnsecondarytextundercursor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btnsecondarytextundercursor.caption"
msgid ">>"
msgstr ">>"

#: tfrmoptionstreeviewmenucolor.btnshortcutcolor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btnshortcutcolor.caption"
msgid ">>"
msgstr ">>"

#: tfrmoptionstreeviewmenucolor.btnshortcutundercursor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btnshortcutundercursor.caption"
msgid ">>"
msgstr ">>"

#: tfrmoptionstreeviewmenucolor.btnunselectabletextcolor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btnunselectabletextcolor.caption"
msgid ">>"
msgstr ">>"

#: tfrmoptionstreeviewmenucolor.btnunselectableundercursor.caption
msgctxt "tfrmoptionstreeviewmenucolor.btnunselectableundercursor.caption"
msgid ">>"
msgstr ">>"

#: tfrmoptionstreeviewmenucolor.cbkusagekeyboardshortcut.caption
msgid "Use and display keyboard shortcut for choosing items"
msgstr ""

#: tfrmoptionstreeviewmenucolor.gblayoutandcolors.caption
msgid "Layout and colors options:"
msgstr ""

#: tfrmoptionstreeviewmenucolor.lblbackgroundcolor.caption
msgid "Background color:"
msgstr "Hintergrundfarbe:"

#: tfrmoptionstreeviewmenucolor.lblcursorcolor.caption
msgid "Cursor color:"
msgstr "Cursorfarbe:"

#: tfrmoptionstreeviewmenucolor.lblfoundtextcolor.caption
msgid "Found text color:"
msgstr ""

#: tfrmoptionstreeviewmenucolor.lblfoundtextundercursor.caption
msgid "Found text under cursor:"
msgstr ""

#: tfrmoptionstreeviewmenucolor.lblnormaltextcolor.caption
msgid "Normal text color:"
msgstr ""

#: tfrmoptionstreeviewmenucolor.lblnormaltextundercursor.caption
msgid "Normal text under cursor:"
msgstr ""

#: tfrmoptionstreeviewmenucolor.lblpreview.caption
msgid "Tree View Menu Preview:"
msgstr "Baumansicht Menü Vorschau:"

#: tfrmoptionstreeviewmenucolor.lblsecondarytextcolor.caption
msgid "Secondary text color:"
msgstr ""

#: tfrmoptionstreeviewmenucolor.lblsecondarytextundercursor.caption
msgid "Secondary text under cursor:"
msgstr ""

#: tfrmoptionstreeviewmenucolor.lblshortcutcolor.caption
msgid "Shortcut color:"
msgstr "Tastaturkürzel Farbe:"

#: tfrmoptionstreeviewmenucolor.lblshortcutundercursor.caption
msgid "Shortcut under cursor:"
msgstr ""

#: tfrmoptionstreeviewmenucolor.lblunselectabletextcolor.caption
msgid "Unselectable text color:"
msgstr ""

#: tfrmoptionstreeviewmenucolor.lblunselectableundercursor.caption
msgid "Unselectable under cursor:"
msgstr ""

#: tfrmoptionstreeviewmenucolor.treeviewmenusample.hint
msgid "Change color on left and you'll see here a preview of what your Tree View Menus will look likes with this sample."
msgstr ""

#: tfrmoptionsviewer.btnbackviewercolor.caption
msgctxt "TFRMOPTIONSVIEWER.BTNBACKVIEWERCOLOR.CAPTION"
msgid ">>"
msgstr ">>"

#: tfrmoptionsviewer.btnfontviewercolor.caption
msgctxt "TFRMOPTIONSVIEWER.BTNFONTVIEWERCOLOR.CAPTION"
msgid ">>"
msgstr ">>"

#: tfrmoptionsviewer.gbviewerbookmode.caption
msgid "Viewer Book Mode"
msgstr "Buchartige Ansicht"

#: tfrmoptionsviewer.gbviewerexample.caption
msgctxt "TFRMOPTIONSVIEWER.GBVIEWEREXAMPLE.CAPTION"
msgid "Example"
msgstr "Beispiel"

#: tfrmoptionsviewer.lblbackgroundcolorviewerbook.caption
msgid "&Background color in book viewer"
msgstr "Hintergrundfarbe in der &buchartigen Ansicht"

#: tfrmoptionsviewer.lblfontcolorviewerbook.caption
msgid "&Font color in book viewer"
msgstr "Schri&ftfarbe in der buchartigen Ansicht"

#: tfrmoptionsviewer.lblnumbercolumnsviewer.caption
msgid "&Number of columns in book viewer"
msgstr "A&nzahl der Spalten in der buchartigen Ansicht"

#: tfrmpackdlg.btnconfig.caption
msgctxt "TFRMPACKDLG.BTNCONFIG.CAPTION"
msgid "Con&figure"
msgstr "Kon&figurieren"

#: tfrmpackdlg.caption
msgctxt "TFRMPACKDLG.CAPTION"
msgid "Pack files"
msgstr "Packe Dateien"

#: tfrmpackdlg.cbcreateseparatearchives.caption
msgid "C&reate separate archives, one per selected file/dir"
msgstr "Für jede ausgewählte Datei/Verzeichnis ein seperates Archiv erstellen"

#: tfrmpackdlg.cbcreatesfx.caption
msgid "Create self e&xtracting archive"
msgstr "SF&X-Archiv erstellen"

#: tfrmpackdlg.cbencrypt.caption
msgid "Encr&ypt"
msgstr "Verschl&üsseln"

#: tfrmpackdlg.cbmovetoarchive.caption
msgid "Mo&ve to archive"
msgstr "In Archiv &verschieben"

#: tfrmpackdlg.cbmultivolume.caption
msgid "&Multiple disk archive"
msgstr "Archiv auf&teilen"

#: tfrmpackdlg.cbotherplugins.caption
msgid "=>"
msgstr "=>"

#: tfrmpackdlg.cbputintarfirst.caption
msgid "P&ut in the TAR archive first"
msgstr "Z&uerst in einem TAR-Archiv zusammenfassen"

#: tfrmpackdlg.cbstoredir.caption
msgid "Also &pack path names (only recursed)"
msgstr "Pfadnamen &mitspeichern (nur abwärts)"

#: tfrmpackdlg.lblprompt.caption
msgid "Pack file(s) to the file:"
msgstr "Packe Datei(en) in Archiv"

#: tfrmpackdlg.rgpacker.caption
msgid "Packer"
msgstr "Packer"

#: tfrmpackinfodlg.btnclose.caption
msgctxt "TFRMPACKINFODLG.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr "S&chließen"

#: tfrmpackinfodlg.btnunpackallandexec.caption
msgid "Unpack &all and execute"
msgstr "&Alle entpacken und ausführen"

#: tfrmpackinfodlg.btnunpackandexec.caption
msgid "&Unpack and execute"
msgstr "&Entpacken und ausführen"

#: tfrmpackinfodlg.caption
msgctxt "TFRMPACKINFODLG.CAPTION"
msgid "Properties of packed file"
msgstr "Eigenschaften der gepackten Datei(en)"

#: tfrmpackinfodlg.lblattributes.caption
msgid "Attributes:"
msgstr "Attribute:"

#: tfrmpackinfodlg.lblcompressionratio.caption
msgid "Compression ratio:"
msgstr "Kompressionsverhältnis:"

#: tfrmpackinfodlg.lbldate.caption
msgid "Date:"
msgstr "Datum:"

#: tfrmpackinfodlg.lblmethod.caption
msgid "Method:"
msgstr "Methode:"

#: tfrmpackinfodlg.lbloriginalsize.caption
msgid "Original size:"
msgstr "Originalgröße"

#: tfrmpackinfodlg.lblpackedfile.caption
msgid "File:"
msgstr "Datei:"

#: tfrmpackinfodlg.lblpackedsize.caption
msgid "Packed size:"
msgstr "Gepackte Größe:"

#: tfrmpackinfodlg.lblpacker.caption
msgid "Packer:"
msgstr "Packer:"

#: tfrmpackinfodlg.lbltime.caption
msgid "Time:"
msgstr "Zeit:"

#: tfrmquicksearch.btncancel.caption
msgctxt "tfrmquicksearch.btncancel.caption"
msgid "X"
msgstr "X"

#: tfrmquicksearch.btncancel.hint
msgid "Close filter panel"
msgstr "Filter-Panel schließen"

#: tfrmquicksearch.edtsearch.hint
msgid "Enter text to search for or filter by"
msgstr "Text eingeben, nach dem gesucht oder gefiltert werden soll"

#: tfrmquicksearch.sbcasesensitive.caption
msgid "Aa"
msgstr ""

#: tfrmquicksearch.sbcasesensitive.hint
msgid "Case Sensitive"
msgstr "Abhängig von der Schreibweise"

#: tfrmquicksearch.sbdirectories.caption
msgid "D"
msgstr ""

#: tfrmquicksearch.sbdirectories.hint
msgctxt "tfrmquicksearch.sbdirectories.hint"
msgid "Directories"
msgstr "Verzeichnisse"

#: tfrmquicksearch.sbfiles.caption
msgid "F"
msgstr ""

#: tfrmquicksearch.sbfiles.hint
msgctxt "tfrmquicksearch.sbfiles.hint"
msgid "Files"
msgstr "Dateien"

#: tfrmquicksearch.sbmatchbeginning.caption
msgid "{"
msgstr ""

#: tfrmquicksearch.sbmatchbeginning.hint
msgid "Match Beginning"
msgstr "Entspricht dem Anfang"

#: tfrmquicksearch.sbmatchending.caption
msgid "}"
msgstr ""

#: tfrmquicksearch.sbmatchending.hint
msgid "Match Ending"
msgstr "Entspricht der Endung"

#: tfrmquicksearch.tglfilter.caption
msgctxt "tfrmquicksearch.tglfilter.caption"
msgid "Filter"
msgstr "Filter"

#: tfrmquicksearch.tglfilter.hint
msgid "Toggle between search or filter"
msgstr "Umschalten zwischen Suchen und Filtern"

#: tfrmsearchplugin.btnadd.caption
msgid "&More rules"
msgstr "&Mehr Regeln"

#: tfrmsearchplugin.btndelete.caption
msgid "L&ess rules"
msgstr "W&eniger Regeln"

#: tfrmsearchplugin.chkuseplugins.caption
msgid "Use &content plugins, combine with:"
msgstr "Nutze Inhalt-Plugins, kombiniere mit:"

#: tfrmsearchplugin.headercontrol.sections[0].text
msgctxt "tfrmsearchplugin.headercontrol.sections[0].text"
msgid "Plugin"
msgstr "Plugin"

#: tfrmsearchplugin.headercontrol.sections[1].text
msgid "Field"
msgstr "Feld"

#: tfrmsearchplugin.headercontrol.sections[2].text
msgid "Operator"
msgstr "Operator"

#: tfrmsearchplugin.headercontrol.sections[3].text
msgctxt "tfrmsearchplugin.headercontrol.sections[3].text"
msgid "Value"
msgstr "Wert"

#: tfrmsearchplugin.rband.caption
msgid "&AND (all match)"
msgstr "&UND (alles stimmt überein)"

#: tfrmsearchplugin.rbor.caption
msgid "&OR (any match)"
msgstr "&ODER (irgendeine Übereinstimmung)"

#: tfrmselecttextrange.btppanel.cancelbutton.caption
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.CANCELBUTTON.CAPTION"
msgid "Cancel"
msgstr "Abbrechen"

#: tfrmselecttextrange.btppanel.closebutton.caption
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.CLOSEBUTTON.CAPTION"
msgid "&Close"
msgstr "S&chließen"

#: tfrmselecttextrange.btppanel.helpbutton.caption
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.HELPBUTTON.CAPTION"
msgid "&Help"
msgstr "&Hilfe"

#: tfrmselecttextrange.btppanel.okbutton.caption
msgctxt "tfrmselecttextrange.btppanel.okbutton.caption"
msgid "&OK"
msgstr "&OK"

#: tfrmselecttextrange.lblselecttext.caption
msgid "&Select the characters to insert:"
msgstr "Zeichen zum Einfügen au&swählen:"

#: tfrmsetfileproperties.btncancel.caption
msgctxt "TFRMSETFILEPROPERTIES.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Abbrechen"

#: tfrmsetfileproperties.btnok.caption
msgctxt "TFRMSETFILEPROPERTIES.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"

#: tfrmsetfileproperties.caption
msgid "Change attributes"
msgstr "Ändern von Dateieigenschaften"

#: tfrmsetfileproperties.cbsgid.caption
msgctxt "TFRMSETFILEPROPERTIES.CBSGID.CAPTION"
msgid "SGID"
msgstr "SGID"

#: tfrmsetfileproperties.cbsticky.caption
msgctxt "TFRMSETFILEPROPERTIES.CBSTICKY.CAPTION"
msgid "Sticky"
msgstr "Dauerhaft"

#: tfrmsetfileproperties.cbsuid.caption
msgctxt "TFRMSETFILEPROPERTIES.CBSUID.CAPTION"
msgid "SUID"
msgstr "SUID"

#: tfrmsetfileproperties.chkarchive.caption
msgctxt "TFRMSETFILEPROPERTIES.CHKARCHIVE.CAPTION"
msgid "Archive"
msgstr "Archiv"

#: tfrmsetfileproperties.chkcreationtime.caption
msgctxt "TFRMSETFILEPROPERTIES.CHKCREATIONTIME.CAPTION"
msgid "Created:"
msgstr "Erstellt:"

#: tfrmsetfileproperties.chkhidden.caption
msgctxt "TFRMSETFILEPROPERTIES.CHKHIDDEN.CAPTION"
msgid "Hidden"
msgstr "Versteckt"

#: tfrmsetfileproperties.chklastaccesstime.caption
msgid "Accessed:"
msgstr "Zugriff:"

#: tfrmsetfileproperties.chklastwritetime.caption
msgid "Modified:"
msgstr "Geändert"

#: tfrmsetfileproperties.chkreadonly.caption
msgctxt "TFRMSETFILEPROPERTIES.CHKREADONLY.CAPTION"
msgid "Read only"
msgstr "Schreibgeschützt"

#: tfrmsetfileproperties.chkrecursive.caption
msgid "Including subfolders"
msgstr "Auch Unterverzeichnisse"

#: tfrmsetfileproperties.chksystem.caption
msgctxt "TFRMSETFILEPROPERTIES.CHKSYSTEM.CAPTION"
msgid "System"
msgstr "System"

#: tfrmsetfileproperties.gbtimesamp.caption
msgid "Timestamp properties"
msgstr "Zeitstempel-Eigenschaften"

#: tfrmsetfileproperties.gbunixattributes.caption
msgctxt "TFRMSETFILEPROPERTIES.GBUNIXATTRIBUTES.CAPTION"
msgid "Attributes"
msgstr "Attribute"

#: tfrmsetfileproperties.gbwinattributes.caption
msgctxt "TFRMSETFILEPROPERTIES.GBWINATTRIBUTES.CAPTION"
msgid "Attributes"
msgstr "Attribute"

#: tfrmsetfileproperties.lblattrbitsstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRBITSSTR.CAPTION"
msgid "Bits:"
msgstr "Bits:"

#: tfrmsetfileproperties.lblattrgroupstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION"
msgid "Group"
msgstr "Gruppe"

#: tfrmsetfileproperties.lblattrinfo.caption
msgctxt "tfrmsetfileproperties.lblattrinfo.caption"
msgid "(gray field means unchanged value)"
msgstr "(Ein graues Feld bedeutet, dass ein Wert unverändert bleibt)"

#: tfrmsetfileproperties.lblattrotherstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTROTHERSTR.CAPTION"
msgid "Other"
msgstr "Andere"

#: tfrmsetfileproperties.lblattrownerstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTROWNERSTR.CAPTION"
msgid "Owner"
msgstr "Besitzer"

#: tfrmsetfileproperties.lblattrtext.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXT.CAPTION"
msgid "-----------"
msgstr "-----------"

#: tfrmsetfileproperties.lblattrtextstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXTSTR.CAPTION"
msgid "Text:"
msgstr "Text:"

#: tfrmsetfileproperties.lblexec.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLEXEC.CAPTION"
msgid "Execute"
msgstr "Ausführen"

#: tfrmsetfileproperties.lblmodeinfo.caption
msgctxt "tfrmsetfileproperties.lblmodeinfo.caption"
msgid "(gray field means unchanged value)"
msgstr "(Ein graues Feld bedeutet, dass ein Wert unverändert bleibt)"

#: tfrmsetfileproperties.lbloctal.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLOCTAL.CAPTION"
msgid "Octal:"
msgstr "Oktal:"

#: tfrmsetfileproperties.lblread.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLREAD.CAPTION"
msgid "Read"
msgstr "Lesen"

#: tfrmsetfileproperties.lblwrite.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLWRITE.CAPTION"
msgid "Write"
msgstr "Schreiben"

#: tfrmsplitter.btncancel.caption
msgctxt "TFRMSPLITTER.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Ende"

#: tfrmsplitter.btnftchoice.caption
msgctxt "TFRMSPLITTER.BTNFTCHOICE.CAPTION"
msgid "..."
msgstr "..."

#: tfrmsplitter.btnok.caption
msgctxt "TFRMSPLITTER.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"

#: tfrmsplitter.btnrelativeftchoice.hint
msgctxt "tfrmsplitter.btnrelativeftchoice.hint"
msgid "Some functions to select appropriate path"
msgstr "Einige Funktionen um angemessene Pfade zu wählen"

#: tfrmsplitter.caption
msgctxt "TFRMSPLITTER.CAPTION"
msgid "Splitter"
msgstr "Teiler"

#: tfrmsplitter.cbrequireacrc32verificationfile.caption
msgid "Require a CRC32 verification file"
msgstr "Benötigt eine CRC32-Datei zum Verifizieren"

#: tfrmsplitter.cmbxsize.text
msgid "1457664B - 3.5\""
msgstr "1457664B - 3.5\""

#: tfrmsplitter.grbxfile.caption
msgctxt "TFRMSPLITTER.GRBXFILE.CAPTION"
msgid "File name"
msgstr "Dateiname"

#: tfrmsplitter.grbxsize.caption
msgid "Size and number of parts"
msgstr "Größe und Anzahl der Teilstücke"

#: tfrmsplitter.lbdirtarget.caption
msgid "Directory &target"
msgstr "&Zielverzeichnis"

#: tfrmsplitter.lbfilesource.caption
msgid "File &source"
msgstr "Datei&quelle"

#: tfrmsplitter.lblnumberparts.caption
msgid "&Number of parts"
msgstr "A&nzahl der Teile"

#: tfrmsplitter.rbtnbyte.caption
msgid "&Bytes"
msgstr "&Bytes"

#: tfrmsplitter.rbtngigab.caption
msgctxt "TFRMSPLITTER.RBTNGIGAB.CAPTION"
msgid "&Gigabytes"
msgstr "&Gigabytes"

#: tfrmsplitter.rbtnkilob.caption
msgctxt "TFRMSPLITTER.RBTNKILOB.CAPTION"
msgid "&Kilobytes"
msgstr "&Kilobytes"

#: tfrmsplitter.rbtnmegab.caption
msgctxt "TFRMSPLITTER.RBTNMEGAB.CAPTION"
msgid "&Megabytes"
msgstr "&Megabytes"

#: tfrmstartingsplash.caption
msgctxt "tfrmstartingsplash.caption"
msgid "Double Commander"
msgstr "Double Commander"

#: tfrmstartingsplash.lblbuild.caption
msgctxt "tfrmstartingsplash.lblbuild.caption"
msgid "Build"
msgstr "Build"

#: tfrmstartingsplash.lblfreepascalver.caption
msgctxt "tfrmstartingsplash.lblfreepascalver.caption"
msgid "Free Pascal"
msgstr "Free Pascal"

#: tfrmstartingsplash.lbllazarusver.caption
msgctxt "tfrmstartingsplash.lbllazarusver.caption"
msgid "Lazarus"
msgstr "Lazarus"

#: tfrmstartingsplash.lbloperatingsystem.caption
msgid "Operating System"
msgstr "Betriebssystem"

#: tfrmstartingsplash.lblplatform.caption
msgid "Platform"
msgstr "Maschinen-Typ"

#: tfrmstartingsplash.lblrevision.caption
msgctxt "tfrmstartingsplash.lblrevision.caption"
msgid "Revision"
msgstr "Revision"

#: tfrmstartingsplash.lbltitle.caption
msgctxt "tfrmstartingsplash.lbltitle.caption"
msgid "Double Commander"
msgstr "Double Commander"

#: tfrmstartingsplash.lblversion.caption
msgctxt "tfrmstartingsplash.lblversion.caption"
msgid "Version"
msgstr "Version"

#: tfrmstartingsplash.lblwidgetsetver.caption
msgid "WidgetsetVer"
msgstr ""

#: tfrmsymlink.btncancel.caption
msgctxt "TFRMSYMLINK.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "&Abbrechen"

#: tfrmsymlink.btnok.caption
msgctxt "TFRMSYMLINK.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"

#: tfrmsymlink.caption
msgid "Create symbolic link"
msgstr "Erstelle symb. Link"

#: tfrmsymlink.lblexistingfile.caption
msgctxt "TFRMSYMLINK.LBLEXISTINGFILE.CAPTION"
msgid "&Destination that the link will point to"
msgstr "Bestehen&des Ziel, auf das die Verknüpfung zeigen soll"

#: tfrmsymlink.lbllinktocreate.caption
msgctxt "TFRMSYMLINK.LBLLINKTOCREATE.CAPTION"
msgid "&Link name"
msgstr "&Verknüpfungsname"

#: tfrmsyncdirsdlg.btnclose.caption
msgctxt "tfrmsyncdirsdlg.btnclose.caption"
msgid "Close"
msgstr "Schließen"

#: tfrmsyncdirsdlg.btncompare.caption
msgctxt "tfrmsyncdirsdlg.btncompare.caption"
msgid "Compare"
msgstr "Vergleiche"

#: tfrmsyncdirsdlg.btnseldir1.caption
msgctxt "tfrmsyncdirsdlg.btnseldir1.caption"
msgid ">>"
msgstr ">>"

#: tfrmsyncdirsdlg.btnseldir2.caption
msgctxt "tfrmsyncdirsdlg.btnseldir2.caption"
msgid ">>"
msgstr ">>"

#: tfrmsyncdirsdlg.btnsynchronize.caption
msgctxt "tfrmsyncdirsdlg.btnsynchronize.caption"
msgid "Synchronize"
msgstr "Synchronisiere"

#: tfrmsyncdirsdlg.caption
msgid "Synchronize directories"
msgstr "Synchronisiere Verzeichnisse"

#: tfrmsyncdirsdlg.cbextfilter.text
msgctxt "tfrmsyncdirsdlg.cbextfilter.text"
msgid "*.*"
msgstr "*"

#: tfrmsyncdirsdlg.chkasymmetric.caption
msgid "asymmetric"
msgstr "asymetrisch"

#: tfrmsyncdirsdlg.chkbycontent.caption
msgid "by content"
msgstr "nach Inhalt"

#: tfrmsyncdirsdlg.chkignoredate.caption
msgid "ignore date"
msgstr "ignoriere Datum"

#: tfrmsyncdirsdlg.chkonlyselected.caption
msgid "only selected"
msgstr "nur ausgewählte"

#: tfrmsyncdirsdlg.chksubdirs.caption
msgid "Subdirs"
msgstr "Unterverzeichnisse"

#: tfrmsyncdirsdlg.groupbox1.caption
msgid "Show:"
msgstr "Zeige:"

#: tfrmsyncdirsdlg.headerdg.columns[0].title.caption
msgctxt "tfrmsyncdirsdlg.headerdg.columns[0].title.caption"
msgid "Name"
msgstr "Name"

#: tfrmsyncdirsdlg.headerdg.columns[1].title.caption
msgctxt "tfrmsyncdirsdlg.headerdg.columns[1].title.caption"
msgid "Size"
msgstr "Größe"

#: tfrmsyncdirsdlg.headerdg.columns[2].title.caption
msgctxt "tfrmsyncdirsdlg.headerdg.columns[2].title.caption"
msgid "Date"
msgstr "Datum"

#: tfrmsyncdirsdlg.headerdg.columns[3].title.caption
msgid "<=>"
msgstr "<=>"

#: tfrmsyncdirsdlg.headerdg.columns[4].title.caption
msgctxt "tfrmsyncdirsdlg.headerdg.columns[4].title.caption"
msgid "Date"
msgstr "Datum"

#: tfrmsyncdirsdlg.headerdg.columns[5].title.caption
msgctxt "tfrmsyncdirsdlg.headerdg.columns[5].title.caption"
msgid "Size"
msgstr "Größe"

#: tfrmsyncdirsdlg.headerdg.columns[6].title.caption
msgctxt "tfrmsyncdirsdlg.headerdg.columns[6].title.caption"
msgid "Name"
msgstr "Name"

#: tfrmsyncdirsdlg.label1.caption
msgid "(in main window)"
msgstr "(im Hauptfenster)"

#: tfrmsyncdirsdlg.menuitemcompare.caption
msgctxt "tfrmsyncdirsdlg.menuitemcompare.caption"
msgid "Compare"
msgstr "Vergleiche"

#: tfrmsyncdirsdlg.menuitemviewleft.caption
msgid "View left"
msgstr "Ansicht links"

#: tfrmsyncdirsdlg.menuitemviewright.caption
msgid "View right"
msgstr "Ansicht rechts"

#: tfrmsyncdirsdlg.sbcopyleft.caption
msgctxt "tfrmsyncdirsdlg.sbcopyleft.caption"
msgid "<"
msgstr "<"

#: tfrmsyncdirsdlg.sbcopyright.caption
msgctxt "tfrmsyncdirsdlg.sbcopyright.caption"
msgid ">"
msgstr ">"

#: tfrmsyncdirsdlg.sbduplicates.caption
msgid "duplicates"
msgstr "Duplikate"

#: tfrmsyncdirsdlg.sbequal.caption
msgid "="
msgstr "="

#: tfrmsyncdirsdlg.sbnotequal.caption
msgid "!="
msgstr "!="

#: tfrmsyncdirsdlg.sbsingles.caption
msgid "singles"
msgstr "Einzelne"

#: tfrmsyncdirsdlg.statusbar1.panels[0].text
msgid "Please press \"Compare\" to start"
msgstr "Bitte \"Vergleiche\" anklicken um zu beginnen"

#: tfrmsyncdirsperformdlg.caption
msgctxt "tfrmsyncdirsperformdlg.caption"
msgid "Synchronize"
msgstr "Synchronisieren"

#: tfrmsyncdirsperformdlg.chkconfirmoverwrites.caption
msgid "Confirm overwrites"
msgstr "Überschreiben bestätigen"

#: tfrmtreeviewmenu.caption
msgctxt "tfrmtreeviewmenu.caption"
msgid "Tree View Menu"
msgstr "Baumansicht Menü"

#: tfrmtreeviewmenu.lblsearchingentry.caption
msgid "Select your hot directory:"
msgstr ""

#: tfrmtreeviewmenu.pmicasesensitive.caption
msgid "Search is case sensitive"
msgstr ""

#: tfrmtreeviewmenu.pmifullcollapse.caption
msgid "Full collapse"
msgstr ""

#: tfrmtreeviewmenu.pmifullexpand.caption
msgid "Full expand"
msgstr ""

#: tfrmtreeviewmenu.pmiignoreaccents.caption
msgid "Search ignore accents and ligatures"
msgstr ""

#: tfrmtreeviewmenu.pminotcasesensitive.caption
msgid "Search is not case sensitive"
msgstr ""

#: tfrmtreeviewmenu.pminotignoreaccents.caption
msgid "Search is strict regarding accents and ligatures"
msgstr ""

#: tfrmtreeviewmenu.pminotshowwholebranchifmatch.caption
msgid "Don't show the branch content \"just\" because the searched string is found in the branche name"
msgstr ""

#: tfrmtreeviewmenu.pmishowwholebranchifmatch.caption
msgid "If searched string is found in a branch name, show the whole branch even if elements don't match"
msgstr ""

#: tfrmtreeviewmenu.tbcancelandquit.hint
msgid "Close Tree View Menu"
msgstr ""

#: tfrmtreeviewmenu.tbconfigurationtreeviewmenus.hint
#, fuzzy
msgctxt "tfrmtreeviewmenu.tbconfigurationtreeviewmenus.hint"
msgid "Configuration of Tree View Menu"
msgstr "Konfiguration Baumansicht Menü"

#: tfrmtreeviewmenu.tbconfigurationtreeviewmenuscolors.hint
#, fuzzy
msgctxt "tfrmtreeviewmenu.tbconfigurationtreeviewmenuscolors.hint"
msgid "Configuration of Tree View Menu Colors"
msgstr "Konfiguration Baumansicht Menü Farben"

#: tfrmtweakplugin.btnadd.caption
msgid "A&dd new"
msgstr "&Neue hinzufügen"

#: tfrmtweakplugin.btncancel.caption
msgctxt "TFRMTWEAKPLUGIN.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr "A&bbruch"

#: tfrmtweakplugin.btnchange.caption
msgid "C&hange"
msgstr "&Ändern"

#: tfrmtweakplugin.btndefault.caption
msgid "De&fault"
msgstr "&Standard"

#: tfrmtweakplugin.btnok.caption
msgctxt "TFRMTWEAKPLUGIN.BTNOK.CAPTION"
msgid "&OK"
msgstr "&OK"

#: tfrmtweakplugin.btnremove.caption
msgctxt "tfrmtweakplugin.btnremove.caption"
msgid "&Remove"
msgstr "Entfe&rnen"

#: tfrmtweakplugin.caption
msgctxt "TFRMTWEAKPLUGIN.CAPTION"
msgid "Tweak plugin"
msgstr "Anpass-PlugIn"

#: tfrmtweakplugin.cbpk_caps_by_content.caption
msgid "De&tect archive type by content"
msgstr "Archiv&typ am Inhalt erkennen"

#: tfrmtweakplugin.cbpk_caps_delete.caption
msgid "Can de&lete files"
msgstr "Kann Dateien &löschen"

#: tfrmtweakplugin.cbpk_caps_encrypt.caption
msgid "Supports e&ncryption"
msgstr "U&nterstützt Verschlüsselung"

#: tfrmtweakplugin.cbpk_caps_hide.caption
msgid "Sho&w as normal files (hide packer icon)"
msgstr "A&ls normale Dateien zeigen (Packer-Symbol verstecken)"

#: tfrmtweakplugin.cbpk_caps_mempack.caption
msgid "Supports pac&king in memory"
msgstr "Unterstützt &Kompression im Arbeitsspeicher"

#: tfrmtweakplugin.cbpk_caps_modify.caption
msgid "Can &modify existing archives"
msgstr "Ka&nn bestehende Archive verändern"

#: tfrmtweakplugin.cbpk_caps_multiple.caption
msgid "&Archive can contain multiple files"
msgstr "&Archive können mehrere Dateien enthalten"

#: tfrmtweakplugin.cbpk_caps_new.caption
msgid "Can create new archi&ves"
msgstr "Kann neue Archi&ve erstellen"

#: tfrmtweakplugin.cbpk_caps_options.caption
msgid "S&upports the options dialogbox"
msgstr "&Unterstützt die Optionen-Dialogbox"

#: tfrmtweakplugin.cbpk_caps_searchtext.caption
msgid "Allow searchin&g for text in archives"
msgstr "Suche von Te&xt in Archiven erlauben"

#: tfrmtweakplugin.lbldescription.caption
msgctxt "TFRMTWEAKPLUGIN.LBLDESCRIPTION.CAPTION"
msgid "&Description:"
msgstr "&Beschreibung:"

#: tfrmtweakplugin.lbldetectstr.caption
msgid "D&etect string:"
msgstr "&Erkenne String:"

#: tfrmtweakplugin.lblextension.caption
msgctxt "TFRMTWEAKPLUGIN.LBLEXTENSION.CAPTION"
msgid "&Extension:"
msgstr "&Endung:"

#: tfrmtweakplugin.lblflags.caption
msgid "Flags:"
msgstr "Flags:"

#: tfrmtweakplugin.lblname.caption
msgctxt "TFRMTWEAKPLUGIN.LBLNAME.CAPTION"
msgid "&Name:"
msgstr "&Name:"

#: tfrmtweakplugin.lblplugin.caption
msgctxt "TFRMTWEAKPLUGIN.LBLPLUGIN.CAPTION"
msgid "&Plugin:"
msgstr "&Plugin:"

#: tfrmtweakplugin.lblplugin1.caption
msgctxt "TFRMTWEAKPLUGIN.LBLPLUGIN1.CAPTION"
msgid "&Plugin:"
msgstr "&Plugin:"

#: tfrmviewer.actabout.caption
msgctxt "TFRMVIEWER.ACTABOUT.CAPTION"
msgid "About Viewer..."
msgstr "Über den Be&trachter..."

#: tfrmviewer.actabout.hint
msgid "Displays the About message"
msgstr "Zeigt den 'Über'-Dialog"

#: tfrmviewer.actchangeencoding.caption
msgid "Change encoding"
msgstr "Kodierung ändern"

#: tfrmviewer.actcopyfile.caption
msgctxt "TFRMVIEWER.ACTCOPYFILE.CAPTION"
msgid "Copy File"
msgstr "Datei kopieren"

#: tfrmviewer.actcopyfile.hint
msgctxt "TFRMVIEWER.ACTCOPYFILE.HINT"
msgid "Copy File"
msgstr "Datei kopieren"

#: tfrmviewer.actcopytoclipboard.caption
msgctxt "tfrmviewer.actcopytoclipboard.caption"
msgid "Copy To Clipboard"
msgstr "In &Zwischenablage kopieren"

#: tfrmviewer.actcopytoclipboardformatted.caption
msgid "Copy To Clipboard Formatted"
msgstr "In Zwischenablage kopieren mit &Format"

#: tfrmviewer.actdeletefile.caption
msgctxt "TFRMVIEWER.ACTDELETEFILE.CAPTION"
msgid "Delete File"
msgstr "Datei löschen"

#: tfrmviewer.actdeletefile.hint
msgctxt "TFRMVIEWER.ACTDELETEFILE.HINT"
msgid "Delete File"
msgstr "Datei löschen"

#: tfrmviewer.actexitviewer.caption
msgctxt "tfrmviewer.actexitviewer.caption"
msgid "E&xit"
msgstr "&Beenden"

#: tfrmviewer.actfind.caption
msgctxt "tfrmviewer.actfind.caption"
msgid "Find"
msgstr "Finde"

#: tfrmviewer.actfindnext.caption
msgctxt "tfrmviewer.actfindnext.caption"
msgid "Find next"
msgstr "Finde nächste"

#: tfrmviewer.actfindprev.caption
msgctxt "tfrmviewer.actfindprev.caption"
msgid "Find previous"
msgstr "Finde vorherige"

#: tfrmviewer.actfullscreen.caption
msgctxt "tfrmviewer.actfullscreen.caption"
msgid "Full Screen"
msgstr "Ganzer Bildschirm"

#: tfrmviewer.actimagecenter.caption
msgctxt "tfrmviewer.actimagecenter.caption"
msgid "Center"
msgstr "Zentrieren"

#: tfrmviewer.actloadnextfile.caption
msgctxt "TFRMVIEWER.ACTLOADNEXTFILE.CAPTION"
msgid "&Next"
msgstr "&Nächste"

#: tfrmviewer.actloadnextfile.hint
msgid "Load Next File"
msgstr "Nächste Datei laden"

#: tfrmviewer.actloadprevfile.caption
msgctxt "TFRMVIEWER.ACTLOADPREVFILE.CAPTION"
msgid "&Previous"
msgstr "&Vorherige"

#: tfrmviewer.actloadprevfile.hint
msgid "Load Previous File"
msgstr "Vorherige Datei laden"

#: tfrmviewer.actmirrorhorz.caption
msgid "Mirror Horizontally"
msgstr "Horizontal spiegeln"

#: tfrmviewer.actmirrorhorz.hint
msgctxt "tfrmviewer.actmirrorhorz.hint"
msgid "Mirror"
msgstr "Spiegeln"

#: tfrmviewer.actmirrorvert.caption
msgid "Mirror Vertically"
msgstr "Vertikal spiegeln"

#: tfrmviewer.actmovefile.caption
msgctxt "TFRMVIEWER.ACTMOVEFILE.CAPTION"
msgid "Move File"
msgstr "Datei verschieben"

#: tfrmviewer.actmovefile.hint
msgctxt "TFRMVIEWER.ACTMOVEFILE.HINT"
msgid "Move File"
msgstr "Datei verschieben"

#: tfrmviewer.actpreview.caption
msgctxt "tfrmviewer.actpreview.caption"
msgid "Preview"
msgstr "Vorschau"

#: tfrmviewer.actreload.caption
msgctxt "TFRMVIEWER.ACTRELOAD.CAPTION"
msgid "Reload"
msgstr "Neu &laden"

#: tfrmviewer.actreload.hint
msgid "Reload current file"
msgstr "Aktuelle Datei neu laden"

#: tfrmviewer.actrotate180.caption
msgctxt "TFRMVIEWER.ACTROTATE180.CAPTION"
msgid "+ 180"
msgstr "+ 180"

#: tfrmviewer.actrotate180.hint
msgctxt "TFRMVIEWER.ACTROTATE180.HINT"
msgid "Rotate 180 degrees"
msgstr "Um 180 Grad drehen"

#: tfrmviewer.actrotate270.caption
msgctxt "TFRMVIEWER.ACTROTATE270.CAPTION"
msgid "- 90"
msgstr "- 90"

#: tfrmviewer.actrotate270.hint
msgctxt "TFRMVIEWER.ACTROTATE270.HINT"
msgid "Rotate -90 degrees"
msgstr "-90 Grad drehen"

#: tfrmviewer.actrotate90.caption
msgctxt "TFRMVIEWER.ACTROTATE90.CAPTION"
msgid "+ 90"
msgstr "Um 90 Grad drehen"

#: tfrmviewer.actrotate90.hint
msgctxt "TFRMVIEWER.ACTROTATE90.HINT"
msgid "Rotate +90 degrees"
msgstr "Um +90 Grad drehen"

#: tfrmviewer.actsave.caption
msgctxt "tfrmviewer.actsave.caption"
msgid "Save"
msgstr "Speichern"

#: tfrmviewer.actsaveas.caption
msgctxt "TFRMVIEWER.ACTSAVEAS.CAPTION"
msgid "Save As..."
msgstr "Speichern unter..."

#: tfrmviewer.actsaveas.hint
msgid "Save File As..."
msgstr "Datei speichern unter..."

#: tfrmviewer.actscreenshot.caption
msgctxt "tfrmviewer.actscreenshot.caption"
msgid "Screenshot"
msgstr "Anzeige als Bild kopieren (Screenshot)"

#: tfrmviewer.actscreenshotdelay3sec.caption
msgid "Delay 3 sec"
msgstr "3 Sekunden verzögern"

#: tfrmviewer.actscreenshotdelay5sec.caption
msgid "Delay 5 sec"
msgstr "5 Sekunden verzögern"

#: tfrmviewer.actselectall.caption
msgctxt "tfrmviewer.actselectall.caption"
msgid "Select All"
msgstr "Alle mar&kieren"

#: tfrmviewer.actshowasbin.caption
msgctxt "tfrmviewer.actshowasbin.caption"
msgid "Show as &Bin"
msgstr "Bin&är anzeigen"

#: tfrmviewer.actshowasbook.caption
msgctxt "tfrmviewer.actshowasbook.caption"
msgid "Show as B&ook"
msgstr "Wie ein &Buch anzeigen"

#: tfrmviewer.actshowasdec.caption
msgid "Show as &Dec"
msgstr ""

#: tfrmviewer.actshowashex.caption
msgctxt "tfrmviewer.actshowashex.caption"
msgid "Show as &Hex"
msgstr "Als He&x anzeigen"

#: tfrmviewer.actshowastext.caption
msgctxt "tfrmviewer.actshowastext.caption"
msgid "Show as &Text"
msgstr "A&ls Text anzeigen"

#: tfrmviewer.actshowaswraptext.caption
msgctxt "tfrmviewer.actshowaswraptext.caption"
msgid "Show as &Wrap text"
msgstr "&Zeilenumbruch"

#: tfrmviewer.actshowgraphics.caption
msgctxt "tfrmviewer.actshowgraphics.caption"
msgid "Graphics"
msgstr "Bilder"

#: tfrmviewer.actshowplugins.caption
msgctxt "tfrmviewer.actshowplugins.caption"
msgid "Plugins"
msgstr "Plugins"

#: tfrmviewer.actstretchimage.caption
msgctxt "TFRMVIEWER.ACTSTRETCHIMAGE.CAPTION"
msgid "Stretch"
msgstr "Strecken"

#: tfrmviewer.actstretchimage.hint
msgid "Stretch Image"
msgstr "Bild strecken"

#: tfrmviewer.actstretchonlylarge.caption
msgctxt "tfrmviewer.actstretchonlylarge.caption"
msgid "Stretch only large"
msgstr "Nur große strecken"

#: tfrmviewer.actzoom.caption
msgid "Zoom"
msgstr "Vergrössern"

#: tfrmviewer.actzoomin.caption
msgctxt "tfrmviewer.actzoomin.caption"
msgid "Zoom In"
msgstr "Größer darstellen"

#: tfrmviewer.actzoomout.caption
msgctxt "tfrmviewer.actzoomout.caption"
msgid "Zoom Out"
msgstr "Kleiner darstellen"

#: tfrmviewer.btncopyfile.hint
msgctxt "TFRMVIEWER.BTNCOPYFILE.HINT"
msgid "Copy"
msgstr "Kopieren"

#: tfrmviewer.btncopyfile1.hint
msgctxt "TFRMVIEWER.BTNCOPYFILE1.HINT"
msgid "Copy"
msgstr "Kopieren"

#: tfrmviewer.btncuttuimage.hint
msgctxt "TFRMVIEWER.BTNCUTTUIMAGE.HINT"
msgid "Crop"
msgstr "Beschneiden"

#: tfrmviewer.btndeletefile.hint
msgctxt "TFRMVIEWER.BTNDELETEFILE.HINT"
msgid "Delete"
msgstr "&Löschen"

#: tfrmviewer.btndeletefile1.hint
msgctxt "TFRMVIEWER.BTNDELETEFILE1.HINT"
msgid "Delete"
msgstr "&Löschen"

#: tfrmviewer.btnfullscreen.hint
msgctxt "TFRMVIEWER.BTNFULLSCREEN.HINT"
msgid "Full Screen"
msgstr "Ganzer Bildschirm"

#: tfrmviewer.btngifmove.caption
msgctxt "TFRMVIEWER.BTNGIFMOVE.CAPTION"
msgid "||"
msgstr "||"

#: tfrmviewer.btngiftobmp.caption
msgid "S"
msgstr "S"

#: tfrmviewer.btnhightlight.hint
msgctxt "TFRMVIEWER.BTNHIGHTLIGHT.HINT"
msgid "Highlight"
msgstr "Markieren"

#: tfrmviewer.btnmovefile.hint
msgctxt "TFRMVIEWER.BTNMOVEFILE.HINT"
msgid "Move"
msgstr "Verschieben"

#: tfrmviewer.btnmovefile1.hint
msgctxt "TFRMVIEWER.BTNMOVEFILE1.HINT"
msgid "Move"
msgstr "Verschieben"

#: tfrmviewer.btnnextgifframe.caption
msgid "||>"
msgstr "||>"

#: tfrmviewer.btnpaint.hint
msgctxt "TFRMVIEWER.BTNPAINT.HINT"
msgid "Paint"
msgstr "Malen"

#: tfrmviewer.btnprevgifframe.caption
msgid "<||"
msgstr "<||"

#: tfrmviewer.btnredeye.hint
msgid "Red Eyes"
msgstr "Rote Augen"

#: tfrmviewer.btnresize.hint
msgctxt "TFRMVIEWER.BTNRESIZE.HINT"
msgid "Resize"
msgstr "Größe ändern"

#: tfrmviewer.btnundo.hint
msgctxt "TFRMVIEWER.BTNUNDO.HINT"
msgid "Undo"
msgstr "Rückgängig machen"

#: tfrmviewer.caption
msgctxt "tfrmviewer.caption"
msgid "Viewer"
msgstr "Schnellansicht"

#: tfrmviewer.cbslideshow.caption
msgctxt "TFRMVIEWER.CBSLIDESHOW.CAPTION"
msgid "Slide Show"
msgstr "Bilder automatisch nacheinander anzeigen (Slideshow)"

#: tfrmviewer.comboboxpaint.text
msgid "Pen"
msgstr "Stift"

#: tfrmviewer.comboboxwidth.text
msgctxt "TFRMVIEWER.COMBOBOXWIDTH.TEXT"
msgid "1"
msgstr "1"

#: tfrmviewer.gboxhightlight.caption
msgctxt "TFRMVIEWER.GBOXHIGHTLIGHT.CAPTION"
msgid "Highlight"
msgstr "Markieren"

#: tfrmviewer.gboxpaint.caption
msgctxt "TFRMVIEWER.GBOXPAINT.CAPTION"
msgid "Paint"
msgstr "Malen"

#: tfrmviewer.gboxslideshow.caption
msgctxt "TFRMVIEWER.GBOXSLIDESHOW.CAPTION"
msgid "Slide Show"
msgstr "Bilder automatisch nacheinander anzeigen (Slideshow)"

#: tfrmviewer.gboxview.caption
msgctxt "TFRMVIEWER.GBOXVIEW.CAPTION"
msgid "View"
msgstr "Betrachten"

#: tfrmviewer.lblhightlight.caption
msgid "0x0"
msgstr "0x0"

#: tfrmviewer.miabout.caption
msgctxt "TFRMVIEWER.MIABOUT.CAPTION"
msgid "About"
msgstr "&Über"

#: tfrmviewer.midiv1.caption
msgctxt "TFRMVIEWER.MIDIV1.CAPTION"
msgid "-"
msgstr "-"

#: tfrmviewer.midiv2.caption
msgctxt "TFRMVIEWER.MIDIV2.CAPTION"
msgid "-"
msgstr "-"

#: tfrmviewer.midiv3.caption
msgctxt "TFRMVIEWER.MIDIV3.CAPTION"
msgid "-"
msgstr "-"

#: tfrmviewer.midiv4.caption
msgctxt "TFRMVIEWER.MIDIV4.CAPTION"
msgid "-"
msgstr "-"

#: tfrmviewer.midiv5.caption
msgctxt "TFRMVIEWER.MIDIV5.CAPTION"
msgid "-"
msgstr "-"

#: tfrmviewer.miedit.caption
msgctxt "TFRMVIEWER.MIEDIT.CAPTION"
msgid "&Edit"
msgstr "&Bearbeiten"

#: tfrmviewer.miencoding.caption
msgctxt "TFRMVIEWER.MIENCODING.CAPTION"
msgid "En&coding"
msgstr "&Kodierung"

#: tfrmviewer.mifile.caption
msgctxt "TFRMVIEWER.MIFILE.CAPTION"
msgid "&File"
msgstr "&Datei"

#: tfrmviewer.miimage.caption
msgid "&Image"
msgstr "B&ild"

#: tfrmviewer.miprint.caption
msgid "Print..."
msgstr "Drucken..."

#: tfrmviewer.mirotate.caption
msgid "Rotate"
msgstr "Drehen"

#: tfrmviewer.miscreenshot.caption
msgctxt "TFRMVIEWER.MISCREENSHOT.CAPTION"
msgid "Screenshot"
msgstr "Anzeige kopieren (Screenshot)"

#: tfrmviewer.miseparator.caption
msgctxt "TFRMVIEWER.MISEPARATOR.CAPTION"
msgid "-"
msgstr "-"

#: tfrmviewer.miview.caption
msgctxt "TFRMVIEWER.MIVIEW.CAPTION"
msgid "&View"
msgstr "&Anzeigen"

#: tfrmviewer.pmiselectall.caption
msgctxt "TFRMVIEWER.PMISELECTALL.CAPTION"
msgid "Select All"
msgstr "Alle mar&kieren"

#: tmultiarchivecopyoperationoptionsui.lblfileexists.caption
msgctxt "tmultiarchivecopyoperationoptionsui.lblfileexists.caption"
msgid "When file exists"
msgstr "Wenn die Datei vorhanden ist"

#: twcxarchivecopyoperationoptionsui.lblfileexists.caption
msgctxt "twcxarchivecopyoperationoptionsui.lblfileexists.caption"
msgid "When file exists"
msgstr "Wenn die Datei vorhanden ist"

#: twfxplugincopymoveoperationoptionsui.cbcopytime.caption
msgctxt "twfxplugincopymoveoperationoptionsui.cbcopytime.caption"
msgid "Copy d&ate/time"
msgstr "D&atum/Zeit kopieren"

#: twfxplugincopymoveoperationoptionsui.cbworkinbackground.caption
msgid "Work in background (separate connection)"
msgstr "Im Hintergrund ausführen (eigene Verbindung)"

#: twfxplugincopymoveoperationoptionsui.lblfileexists.caption
msgctxt "TWFXPLUGINCOPYMOVEOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
msgid "When file exists"
msgstr "Wenn Datei vorhanden"

#: uexifreader.rsdatetimeoriginal
msgid "Date taken"
msgstr ""

#: uexifreader.rsimageheight
#, fuzzy
msgctxt "uexifreader.rsimageheight"
msgid "Height"
msgstr "Höhe"

#: uexifreader.rsimagewidth
#, fuzzy
msgctxt "uexifreader.rsimagewidth"
msgid "Width"
msgstr "Breite"

#: uexifreader.rsmake
msgid "Manufacturer"
msgstr ""

#: uexifreader.rsmodel
msgid "Camera model"
msgstr ""

#: uexifreader.rsorientation
msgid "Orientation"
msgstr ""

#: ulng.msgtrytolocatecrcfile
msgid ""
"This file cannot be found and could help to validate final combination of files:\n"
"%s\n"
"\n"
"Could you make it available and press \"OK\" when ready,\n"
"or press \"CANCEL\" to continue without it?\n"
msgstr ""
"Die Datei konnte nicht gefunden werden, aber könnte helfen die vorhandenen zu prüfen:\n"
"%s\n"
"\n"
"Kann sie manuell zur Verfügung gestellt werden? Dann bitte \"Ok\" klicken,\n"
"oder \"Abbrechen\" klicken um ohne sie fortzusetzen.\n"

#: ulng.rscancelfilter
msgid "Cancel Quick Filter"
msgstr "Schnell-Filter abbrechen"

#: ulng.rscanceloperation
msgid "Cancel Current Operation"
msgstr "Aktuellen Vorgang abbrechen"

#: ulng.rscaptionforaskingfilename
msgid "Enter filename, with extension, for dropped text"
msgstr "Dateinamen eingeben, mit Endung, für gezogenen Text"

#: ulng.rscaptionfortextformattoimport
msgid "Text format to import"
msgstr "Zu importierendes Textformat"

#: ulng.rschecksumverifybroken
msgid "Broken:"
msgstr "Kompromitiert:"

#: ulng.rschecksumverifygeneral
msgid "General:"
msgstr "Allgemein:"

#: ulng.rschecksumverifymissing
msgid "Missing:"
msgstr "Fehlend:"

#: ulng.rschecksumverifyreaderror
msgid "Read error:"
msgstr "Lesefehler:"

#: ulng.rschecksumverifysuccess
msgid "Success:"
msgstr "Erfolg:"

#: ulng.rschecksumverifytext
msgid "Enter checksum and select algorithm:"
msgstr "Prüfsumme eingeben und Algorithmus auswählen"

#: ulng.rschecksumverifytitle
msgid "Verify checksum"
msgstr "Checksum verifizieren"

#: ulng.rschecksumverifytotal
msgid "Total:"
msgstr "Gesamt:"

#: ulng.rsclearfiltersornot
msgid "Do you want to clear filters for this new search?"
msgstr ""

#: ulng.rsclipboardcontainsinvalidtoolbardata
msgid "Clipboard doesn't contain any valid toolbar data."
msgstr "Die Zwischenablage enthält keine gültigen Daten für die Werkzeugleiste."

#: ulng.rscmdcategorylistinorder
msgid "All;Active Panel;Left Panel;Right Panel;File Operations;Configuration;Network;Miscellaneous;Parallel Port;Print;Mark;Security;Clipboard;FTP;Navigation;Help;Window;Command Line;Tools;View;User;Tabs;Sorting;Log"
msgstr "Alle;aktives Panel;Linkes Panel;rechtes Panel;Datei-Operationen;Konfiguration;Netzwerk;Verschiedenes;Paralleler Anschluss;Druck;Markierung;Sicherheit;Zwischenablage;FTP;Navigation;Hilfe;Fenster;Befehlszeile;Werkzeuge;Ansicht;Benutzer;Tabs;Sortierung;Log"

#: ulng.rscmdkindofsort
msgid "Legacy sorted;A-Z sorted"
msgstr "Ablauf sortiert;A-Z sortiert"

#: ulng.rscolattr
msgid "Attr"
msgstr "Attribute"

#: ulng.rscoldate
msgctxt "ulng.rscoldate"
msgid "Date"
msgstr "Datum"

#: ulng.rscolext
msgid "Ext"
msgstr "Erw."

#: ulng.rscolname
msgctxt "ulng.rscolname"
msgid "Name"
msgstr "Name"

#: ulng.rscolsize
msgctxt "ulng.rscolsize"
msgid "Size"
msgstr "Größe"

#: ulng.rsconfcolalign
msgid "Align"
msgstr "Ausrichten"

#: ulng.rsconfcolcaption
msgid "Caption"
msgstr "Überschrift"

#: ulng.rsconfcoldelete
msgctxt "ulng.rsconfcoldelete"
msgid "Delete"
msgstr "&Löschen"

#: ulng.rsconfcolfieldcont
msgid "Field contents"
msgstr "Feldinhalt"

#: ulng.rsconfcolmove
msgctxt "ulng.rsconfcolmove"
msgid "Move"
msgstr "Verschieben"

#: ulng.rsconfcolwidth
msgctxt "ulng.rsconfcolwidth"
msgid "Width"
msgstr "Breite"

#: ulng.rsconfcustheader
msgid "Customize column"
msgstr "Spalten anpassen"

#: ulng.rsconfigurationfileassociation
msgid "Configure file association"
msgstr "Dateiverknüpfungen konfigurieren"

#: ulng.rsconfirmexecution
msgid "Confirming command line and parameters"
msgstr "Befehlszeile und Parameter bestätigen"

#: ulng.rscopynametemplate
msgid "Copy (%d) %s"
msgstr "Kopie (%d) %s"

#: ulng.rsdefaultimporteddctoolbarhint
msgid "Imported DC toolbar"
msgstr "Importierte DC-Toolbar"

#: ulng.rsdefaultimportedtctoolbarhint
msgid "Imported TC toolbar"
msgstr "Importierte TC-Toolbar"

#: ulng.rsdefaultsuffixdroppedtext
msgid "_DroppedText"
msgstr "_Gezogener Text"

#: ulng.rsdefaultsuffixdroppedtexthtmlfilename
msgid "_DroppedHTMLtext"
msgstr "_Gezogener HTML-Text"

#: ulng.rsdefaultsuffixdroppedtextrichtextfilename
msgid "_DroppedRichtext"
msgstr "_Gezogener RichText"

#: ulng.rsdefaultsuffixdroppedtextsimplefilename
msgid "_DroppedSimpleText"
msgstr "_Gezogener einfacher Text"

#: ulng.rsdefaultsuffixdroppedtextunicodeutf16filename
msgid "_DroppedUnicodeUTF16text"
msgstr "_Gezogener UnicodeUTF16-Text"

#: ulng.rsdefaultsuffixdroppedtextunicodeutf8filename
msgid "_DroppedUnicodeUTF8text"
msgstr "_Gezogener UnicodeUTF8-Text"

#: ulng.rsdiffadds
msgid " Adds: "
msgstr " Fügt hinzu: "

#: ulng.rsdiffdeletes
msgid " Deletes: "
msgstr " Löscht: "

#: ulng.rsdifffilesidentical
msgid "The two files are identical!"
msgstr "Die Dateien sind identisch!"

#: ulng.rsdiffmatches
msgid " Matches: "
msgstr " Entspricht: "

#: ulng.rsdiffmodifies
msgid " Modifies: "
msgstr " Verändert: "

#: ulng.rsdlgbuttonabort
msgid "Ab&ort"
msgstr "&Unterbrechen"

#: ulng.rsdlgbuttonall
msgctxt "ulng.rsdlgbuttonall"
msgid "A&ll"
msgstr "A&lle"

#: ulng.rsdlgbuttonappend
msgid "A&ppend"
msgstr "An&hängen"

#: ulng.rsdlgbuttonautorenamesource
msgid "A&uto-rename source files"
msgstr "Quelldateien a&utomatisch umbenennen"

#: ulng.rsdlgbuttoncancel
msgctxt "ulng.rsdlgbuttoncancel"
msgid "&Cancel"
msgstr "Abbru&ch"

#: ulng.rsdlgbuttoncontinue
msgid "&Continue"
msgstr "Fortset&zen"

#: ulng.rsdlgbuttoncopyinto
#, fuzzy
#| msgid "Copy &Into"
msgid "&Merge"
msgstr "Zunächst nur d&ieses Verzeichnis kopieren"

#: ulng.rsdlgbuttoncopyintoall
#, fuzzy
#| msgid "Copy Into &All"
msgid "Mer&ge All"
msgstr "&Alle bestehenden Verzeichnisse kopieren"

#: ulng.rsdlgbuttonexitprogram
msgid "E&xit program"
msgstr "&Programm beenden"

#: ulng.rsdlgbuttonignore
msgid "Ig&nore"
msgstr ""

#: ulng.rsdlgbuttonignoreall
msgid "I&gnore All"
msgstr "Alle i&gnorieren"

#: ulng.rsdlgbuttonno
msgid "&No"
msgstr "&Nein"

#: ulng.rsdlgbuttonnone
msgid "Non&e"
msgstr "&Keine"

#: ulng.rsdlgbuttonok
msgctxt "ulng.rsdlgbuttonok"
msgid "&OK"
msgstr "&OK"

#: ulng.rsdlgbuttonother
msgid "Ot&her"
msgstr "A&ndere"

#: ulng.rsdlgbuttonoverwrite
msgid "&Overwrite"
msgstr "&Überschreiben"

#: ulng.rsdlgbuttonoverwriteall
msgid "Overwrite &All"
msgstr "Alle &vorhandenen Dateien überschreiben"

#: ulng.rsdlgbuttonoverwritelarger
msgid "Overwrite All &Larger"
msgstr "A&lle größeren Dateien überschreiben"

#: ulng.rsdlgbuttonoverwriteolder
msgid "Overwrite All Ol&der"
msgstr "Alle älteren &Dateien überschreiben"

#: ulng.rsdlgbuttonoverwritesmaller
msgid "Overwrite All S&maller"
msgstr "Alle &kleineren Dateien überschreiben"

#: ulng.rsdlgbuttonrename
msgctxt "ulng.rsdlgbuttonrename"
msgid "R&ename"
msgstr "Umb&enennen"

#: ulng.rsdlgbuttonresume
msgid "&Resume"
msgstr "Fo&rtsetzen"

#: ulng.rsdlgbuttonretry
msgid "Re&try"
msgstr "&Wiederholen"

#: ulng.rsdlgbuttonretryadmin
msgid "As Ad&ministrator"
msgstr ""

#: ulng.rsdlgbuttonskip
msgid "&Skip"
msgstr "Übe&rspringen"

#: ulng.rsdlgbuttonskipall
msgid "S&kip All"
msgstr "Übers&pringe alle"

#: ulng.rsdlgbuttonyes
msgid "&Yes"
msgstr "&Ja"

#: ulng.rsdlgcp
msgctxt "ulng.rsdlgcp"
msgid "Copy file(s)"
msgstr "Datei(en) kopieren"

#: ulng.rsdlgmv
msgid "Move file(s)"
msgstr "Datei(en) verschieben"

#: ulng.rsdlgoppause
msgctxt "ulng.rsdlgoppause"
msgid "Pau&se"
msgstr "Pau&se"

#: ulng.rsdlgopstart
msgctxt "ulng.rsdlgopstart"
msgid "&Start"
msgstr "&Starten"

#: ulng.rsdlgqueue
msgctxt "ulng.rsdlgqueue"
msgid "Queue"
msgstr "Warteschlange"

#: ulng.rsdlgspeed
msgid "Speed %s/s"
msgstr "Geschwindigkeit %s/s"

#: ulng.rsdlgspeedtime
msgid "Speed %s/s, time remaining %s"
msgstr "Geschwindigkeit %s/s, verbleibende Zeit %s"

#: ulng.rsdraganddroptextformat
msgid "Rich Text Format;HTML Format;Unicode Format;Simple Text Format"
msgstr ""

#: ulng.rsdrivenolabel
msgid "<no label>"
msgstr "<keine Bezeichnung>"

#: ulng.rsdrivenomedia
msgid "<no media>"
msgstr "<kein Medium>"

#: ulng.rseditabouttext
msgid "Internal Editor of Double Commander."
msgstr "Interner Text-Editor von Double Commander"

#: ulng.rseditgotolinequery
msgid "Goto line:"
msgstr "Gehe zu Zeile:"

#: ulng.rseditgotolinetitle
msgctxt "ulng.rseditgotolinetitle"
msgid "Goto Line"
msgstr "Gehe zu Zeile"

#: ulng.rseditnewfile
msgid "new.txt"
msgstr "Neu.txt"

#: ulng.rseditnewfilename
msgid "Filename:"
msgstr "Dateiname:"

#: ulng.rseditnewopen
msgid "Open file"
msgstr "Öffne Datei"

#: ulng.rseditsearchback
msgid "&Backward"
msgstr "&Zurück"

#: ulng.rseditsearchcaption
msgctxt "ulng.rseditsearchcaption"
msgid "Search"
msgstr "Suchen"

#: ulng.rseditsearchfrw
msgid "&Forward"
msgstr "&Vorwärts"

#: ulng.rseditsearchreplace
msgctxt "ulng.rseditsearchreplace"
msgid "Replace"
msgstr "Ersetzen"

#: ulng.rseditwithexternaleditor
msgid "with external editor"
msgstr "Mit externem Editor"

#: ulng.rseditwithinternaleditor
msgid "with internal editor"
msgstr "Mit internem Editor"

#: ulng.rsexecuteviashell
msgctxt "ulng.rsexecuteviashell"
msgid "Execute via shell"
msgstr "Auf der Befehlszeile ausführen"

#: ulng.rsexecuteviaterminalclose
msgctxt "ulng.rsexecuteviaterminalclose"
msgid "Execute via terminal and close"
msgstr "Im Terminal ausführen und schließen"

#: ulng.rsexecuteviaterminalstayopen
msgctxt "ulng.rsexecuteviaterminalstayopen"
msgid "Execute via terminal and stay open"
msgstr "Im Terminal ausführen und offen lassen"

#: ulng.rsfavtabspanelsideselection
msgid "Left;Right;Active;Inactive;Both;None"
msgstr "Links;Rechts;Aktiv;Inaktiv;Beide;Nichts"

#: ulng.rsfavtabssavedirhistory
msgid "No;Yes"
msgstr "Ja;Nein"

#: ulng.rsfilenameexportedtcbarprefix
msgid "Exported_from_DC"
msgstr "Exportiert_aus_DC"

#: ulng.rsfileopdirectoryexistsoptions
#, fuzzy
#| msgid "Ask;Overwrite;Copy into;Skip"
msgid "Ask;Merge;Skip"
msgstr "Fragen;Überschreiben;Hinein kopieren;Überspringen"

#: ulng.rsfileopfileexistsoptions
msgid "Ask;Overwrite;Overwrite Older;Skip"
msgstr "Fragen;Überschreiben;Ältere überschreiben;Überspringen"

#: ulng.rsfileopsetpropertyerroroptions
msgctxt "ulng.rsfileopsetpropertyerroroptions"
msgid "Ask;Don't set anymore;Ignore errors"
msgstr "Fragen;Niemals setzen;Fehler ignorieren"

#: ulng.rsfilterstatus
msgid "FILTER"
msgstr "Filter"

#: ulng.rsfinddefinetemplate
msgid "Define template"
msgstr "Vorlage definieren"

#: ulng.rsfinddepth
msgid "%s level(s)"
msgstr "%s Level(s)"

#: ulng.rsfinddepthall
msgid "all (unlimited depth)"
msgstr "Alle (Tiefe unbegrenzt)"

#: ulng.rsfinddepthcurdir
msgid "current dir only"
msgstr "Nur das aktuelle Verzeichnis"

#: ulng.rsfinddirnoex
msgid "Directory %s does not exist!"
msgstr "Verzeichnis %s existiert nicht!"

#: ulng.rsfindfound
msgid "Found: %d"
msgstr "Gefunden: %d"

#: ulng.rsfindsavetemplatecaption
msgid "Save search template"
msgstr "Suche als Vorlage speichern"

#: ulng.rsfindsavetemplatetitle
msgid "Template name:"
msgstr "Vorlagen-Name"

#: ulng.rsfindscanned
msgid "Scanned: %d"
msgstr "Gelesen: %d"

#: ulng.rsfindscanning
msgid "Scanning"
msgstr "Suche"

#: ulng.rsfindsearchfiles
msgctxt "ulng.rsfindsearchfiles"
msgid "Find files"
msgstr "Dateien suchen"

#: ulng.rsfindtimeofscan
msgid "Time of scan: "
msgstr "Zeit des Scans:"

#: ulng.rsfindwherebeg
msgid "Begin at"
msgstr "Starte bei"

#: ulng.rsfreemsg
msgid "Free %s from %s bytes"
msgstr "%s Byte von %s frei"

#: ulng.rsfreemsgshort
msgid "%s bytes free"
msgstr "%s Bytes frei"

#: ulng.rsfuncatime
msgid "Access date/time"
msgstr "Datum/Zeit des letzten Zugriffs"

#: ulng.rsfuncattr
msgctxt "ulng.rsfuncattr"
msgid "Attributes"
msgstr "Attribute"

#: ulng.rsfunccomment
msgctxt "ulng.rsfunccomment"
msgid "Comment"
msgstr "Kommentar"

#: ulng.rsfunccompressedsize
msgid "Compressed size"
msgstr "Komprimierte Größe"

#: ulng.rsfuncctime
msgid "Creation date/time"
msgstr "Datum/Zeit der Erstellung"

#: ulng.rsfuncext
msgid "Extension"
msgstr "Endung"

#: ulng.rsfuncgroup
msgctxt "ulng.rsfuncgroup"
msgid "Group"
msgstr "Gruppe"

#: ulng.rsfunchtime
msgid "Change date/time"
msgstr "Datum/Zeit ändern"

#: ulng.rsfunclinkto
msgid "Link to"
msgstr "Vernüpfung mit"

#: ulng.rsfuncmtime
msgid "Modification date/time"
msgstr "Datum/Zeit der letzten Änderung"

#: ulng.rsfuncname
msgctxt "ulng.rsfuncname"
msgid "Name"
msgstr "Name"

#: ulng.rsfuncnamenoext
msgid "Name without extension"
msgstr "Name ohne Endung"

#: ulng.rsfuncowner
msgctxt "ulng.rsfuncowner"
msgid "Owner"
msgstr "Besitzer"

#: ulng.rsfuncpath
msgctxt "ulng.rsfuncpath"
msgid "Path"
msgstr "Pfad"

#: ulng.rsfuncsize
msgctxt "ulng.rsfuncsize"
msgid "Size"
msgstr "Größe"

#: ulng.rsfunctype
msgid "Type"
msgstr "Typ"

#: ulng.rsharderrcreate
msgid "Error creating hardlink."
msgstr "Fehler beim Erstellen des Hardlink."

#: ulng.rshotdirforcesortingorderchoices
msgid "none;Name, a-z;Name, z-a;Ext, a-z;Ext, z-a;Size 9-0;Size 0-9;Date 9-0;Date 0-9"
msgstr "nichts;Name a-z;Name, z-a;Endung, a-z;Endung, z-a;Größe 9-0;Größe 0-9;Datum 9-0;Datum 0-9"

#: ulng.rshotdirwarningabortrestorebackup
msgid ""
"Warning! When restoring a .hotlist backup file, this will erase existing list to replace by the imported one.\n"
"\n"
"Are you sure you want to proceed?\n"
msgstr ""
"Warnung! Wenn eine \"Hotlist\" Backupdatei restauriert wird, wird die existierende durch das Backup ersetzt\n"
"Sicher, dass weiter gemacht werden soll?\n"

#: ulng.rshotkeycategorycopymovedialog
msgid "Copy/Move Dialog"
msgstr "Kopieren/Verschieben-Dialog"

#: ulng.rshotkeycategorydiffer
msgctxt "ulng.rshotkeycategorydiffer"
msgid "Differ"
msgstr "Vergleichsprogramm"

#: ulng.rshotkeycategoryeditcommentdialog
msgid "Edit Comment Dialog"
msgstr "Bearbeite Kommentar-Dialog"

#: ulng.rshotkeycategoryeditor
msgctxt "ulng.rshotkeycategoryeditor"
msgid "Editor"
msgstr "Editor"

#: ulng.rshotkeycategoryfindfiles
msgctxt "ulng.rshotkeycategoryfindfiles"
msgid "Find files"
msgstr "Dateien suchen"

#: ulng.rshotkeycategorymain
msgid "Main"
msgstr "Haupt-Fenster"

#: ulng.rshotkeycategoryviewer
msgctxt "ulng.rshotkeycategoryviewer"
msgid "Viewer"
msgstr "Schnellansicht"

#: ulng.rshotkeyfilealreadyexists
msgid ""
"A setup with that name already exists.\n"
"Do you want to overwrite it?\n"
msgstr ""

#: ulng.rshotkeyfileconfirmdefault
msgid "Are you sure you want to restore default?"
msgstr ""

#: ulng.rshotkeyfileconfirmerasure
msgid "Are you sure you want to erase setup \"%s\"?"
msgstr ""

#: ulng.rshotkeyfilecopyof
msgid "Copy of %s"
msgstr ""

#: ulng.rshotkeyfileinputnewname
msgid "Input your new name"
msgstr ""

#: ulng.rshotkeyfilemustkeepone
msgid "You must keep at least one shortcut file."
msgstr ""

#: ulng.rshotkeyfilenewname
msgid "New name"
msgstr ""

#: ulng.rshotkeyfilesavemodified
msgid ""
"\"%s\" setup has been modified.\n"
"Do you want to save it now?\n"
msgstr ""

#: ulng.rshotkeynoscenter
msgid "No shortcut with \"ENTER\""
msgstr ""

#: ulng.rshotkeysortorder
msgid "By command name;By shortcut key (grouped);By shortcut key (one per row)"
msgstr "nach Kommando-Name;nach Shortcut-Key (gruppiert);nach Shortcut-Key (einer pro Zeile)"

#: ulng.rsimporttoolbarproblem
msgid "Cannot find reference to default bar file"
msgstr "Kann Bezug zur Standard Bar-Datei nicht finden"

#: ulng.rslistoffindfileswindows
msgid "List of \"Find files\" windows"
msgstr ""

#: ulng.rsmarkminus
msgid "Unselect mask"
msgstr "Maske abwählen"

#: ulng.rsmarkplus
msgid "Select mask"
msgstr "Wähle Maske"

#: ulng.rsmaskinput
msgid "Input mask:"
msgstr "Eingabemaske:"

#: ulng.rsmenuconfigurecolumnsalreadyexists
msgid "A columns view with that name already exists."
msgstr "Eine Spaltenansicht mit diesem Namen besteht bereits."

#: ulng.rsmenuconfigurecolumnssavetochange
msgid "To change current editing colmuns view, either SAVE, COPY or DELETE current editing one"
msgstr "Um das aktuelle Bearbeiten der Spaltenansicht zu verändern, die aktuelle entweder SPEICHERN, KOPIEREN oder LÖSCHEN"

#: ulng.rsmenuconfigurecustomcolumns
msgid "Configure custom columns"
msgstr "Bearbeite angepasste Spalten"

#: ulng.rsmenuconfigureentercustomcolumnname
msgid "Enter new custom columns name"
msgstr "Neuen angepassten Namen für die Spaltenansicht angeben"

#: ulng.rsmnuactions
msgctxt "ulng.rsmnuactions"
msgid "Actions"
msgstr "Aktionen"

#: ulng.rsmnucopynetnamestoclip
msgid "Copy names with UNC path"
msgstr ""

#: ulng.rsmnudisconnectnetworkdrive
msgid "Disconnect Network Drive..."
msgstr "Netzwerklaufwerk trennen..."

#: ulng.rsmnuedit
msgctxt "ulng.rsmnuedit"
msgid "Edit"
msgstr "Bea&rbeiten"

#: ulng.rsmnueject
msgid "Eject"
msgstr "Auswerfen"

#: ulng.rsmnuextracthere
msgid "Extract here..."
msgstr "Archiv hier entpacken..."

#: ulng.rsmnumapnetworkdrive
msgid "Map Network Drive..."
msgstr "Netzwerklaufwerk mappen..."

#: ulng.rsmnumount
msgid "Mount"
msgstr "Einbinden"

#: ulng.rsmnunew
msgctxt "ulng.rsmnunew"
msgid "New"
msgstr "Neu"

#: ulng.rsmnunomedia
msgid "No media available"
msgstr "Kein Datenträger verfügbar"

#: ulng.rsmnuopen
msgctxt "ulng.rsmnuopen"
msgid "Open"
msgstr "Öffnen"

#: ulng.rsmnuopenwith
msgid "Open with"
msgstr "Öffnen mit..."

#: ulng.rsmnuopenwithother
msgctxt "ulng.rsmnuopenwithother"
msgid "Other..."
msgstr "Andere..."

#: ulng.rsmnupackhere
msgid "Pack here..."
msgstr "Archiv hier erstellen..."

#: ulng.rsmnusortby
msgid "Sort by"
msgstr "Sortieren"

#: ulng.rsmnuumount
msgid "Unmount"
msgstr "Einbindung lösen"

#: ulng.rsmnuview
msgctxt "ulng.rsmnuview"
msgid "View"
msgstr "Betrachten"

#: ulng.rsmsgaccount
msgid "Account:"
msgstr "Zugang:"

#: ulng.rsmsgalldcintcmds
msgid "All Double Commander internal commands"
msgstr ""

#: ulng.rsmsgarchivercustomparams
msgid "Additional parameters for archiver command-line:"
msgstr "Zusätzliche Parameter für die Befehlszeile des Packers:"

#: ulng.rsmsgaskquoteornot
msgid "Do you want to enclose between quotes?"
msgstr ""

#: ulng.rsmsgbadcrc32
msgid ""
"Bad CRC32 for resulting file:\n"
"\"%s\"\n"
"\n"
"Do you want to keep the resulting corrupted file anyway?\n"
msgstr ""
"Falscher CRC32-Wert für entstehende Datei:\n"
"\"%s\"\n"
"\n"
"Soll die entstehende korrupte Datei trotzdem behalten werden?\n"

#: ulng.rsmsgcannotcopymoveitself
msgid "You can not copy/move a file \"%s\" to itself!"
msgstr "Die Datei \"%s\" kann nicht über sich selbst kopiert/verschoben werden!"

#: ulng.rsmsgcannotdeletedirectory
msgid "Cannot delete directory %s"
msgstr "Kann Verzeichnis %s nicht löschen."

#: ulng.rsmsgcannotoverwritedirectory
msgid "Cannot overwrite directory \"%s\" with non-directory \"%s\""
msgstr ""

#: ulng.rsmsgchdirfailed
msgid "ChDir to [%s] failed!"
msgstr "Verzeichniswechsel nach [%s] fehlgeschlagen"

#: ulng.rsmsgcloseallinactivetabs
msgid "Remove all inactive tabs?"
msgstr "Alle in-aktiven Tabs entfernen?"

#: ulng.rsmsgcloselockedtab
msgid "This tab (%s) is locked! Close anyway?"
msgstr "Dieser Tab (%s) ist gesperrt! Trotzdem schließen?"

#: ulng.rsmsgcofirmuserparam
msgid "Confirmation of parameter"
msgstr ""

#: ulng.rsmsgconfirmquit
msgid "Are you sure you want to quit?"
msgstr "Double Commander wirklich beenden?"

#: ulng.rsmsgcopybackward
msgid "The file %s has changed. Do you want to copy it backward?"
msgstr "Die Datei %s wurde verändert. Soll sie zurückkopiert werden?"

#: ulng.rsmsgcouldnotcopybackward
msgid "Could not copy backward - do you want to keep the changed file?"
msgstr "Zurückkopieren nicht möglich - ssoll die veränderte Datei behalten werden?"

#: ulng.rsmsgcpfldr
msgid "Copy %d selected files/directories?"
msgstr "%d markierte Datei(en)/Verzeichnis(se) kopieren?"

#: ulng.rsmsgcpsel
msgid "Copy selected \"%s\"?"
msgstr "Markierte \"%s\" kopieren?"

#: ulng.rsmsgcreateanewfiletype
msgid "< Create a new file type \"%s files\" >"
msgstr "< Neuen Dateityp erstellen \"%s Dateien\" >"

#: ulng.rsmsgdctoolbarwheretosave
msgid "Enter location and filename where to save a DC Toolbar file"
msgstr "Speicherort und Namen unter dem die Toolbar-Datei gespeichert werden soll"

#: ulng.rsmsgdefaultcustomactionname
msgid "Custom action"
msgstr "Angepasste Aktion"

#: ulng.rsmsgdeletepartiallycopied
msgid "Delete the partially copied file ?"
msgstr "Teilweise kopierte Datei löschen?"

#: ulng.rsmsgdelfldr
msgid "Delete %d selected files/directories?"
msgstr "Löschen von %d ausgewählten Dateien/Verzeichnissen?"

#: ulng.rsmsgdelfldrt
msgid "Delete %d selected files/directories into trash can?"
msgstr "%d markierte Dateien/Verzeichnisse in den Papierkorb verschieben?"

#: ulng.rsmsgdelsel
msgid "Delete selected \"%s\"?"
msgstr "Markierte \"%s\" löschen?"

#: ulng.rsmsgdelselt
msgid "Delete selected \"%s\" into trash can?"
msgstr "Markierte \"%s\" in den Papierkorb verschieben?"

#: ulng.rsmsgdeltotrashforce
msgid "Can not delete \"%s\" to trash! Delete directly?"
msgstr "Kann \"%s\" nicht in den Papierkorb verschieben! Endgültig löschen?"

#: ulng.rsmsgdisknotavail
msgid "Disk is not available"
msgstr "Laufwerk steht nicht zur Verfügung"

#: ulng.rsmsgentercustomaction
msgid "Enter custom action name:"
msgstr "Namen für die angepasste Aktion angeben:"

#: ulng.rsmsgenterfileext
msgid "Enter file extension:"
msgstr "Dateiendung eingeben:"

#: ulng.rsmsgentername
msgid "Enter name:"
msgstr "Namen eingeben:"

#: ulng.rsmsgenternewfiletypename
msgid "Enter name of new file type to create for extension \"%s\""
msgstr "Bitte Namen für die neue Dateiendung \"%s\" angeben"

#: ulng.rsmsgerrbadarchive
msgid "CRC error in archive data"
msgstr "CRC-Fehler in der Archivdatei"

#: ulng.rsmsgerrbaddata
msgid "Data is bad"
msgstr "Datenfehler"

#: ulng.rsmsgerrcannotconnect
msgid "Can not connect to server: \"%s\""
msgstr "Kann nicht mit dem Server \"%s\" verbinden"

#: ulng.rsmsgerrcannotcopyfile
msgid "Cannot copy file %s to %s"
msgstr "Kann die Datei %s nicht zu %s kopieren"

#: ulng.rsmsgerrcreatefiledirectoryexists
msgid "There already exists a directory named \"%s\"."
msgstr "Ein Verzeichnis mit Namen \"%s\" besteht bereits."

#: ulng.rsmsgerrdatenotsupported
msgid "Date %s is not supported"
msgstr "Datum %s wird nicht nicht unterstützt"

#: ulng.rsmsgerrdirexists
msgid "Directory %s exists!"
msgstr "Verzeichnis %s besteht bereits!"

#: ulng.rsmsgerreaborted
msgid "Function aborted by user"
msgstr "Abbruch durch Benutzer"

#: ulng.rsmsgerreclose
msgid "Error closing file"
msgstr "Kann Datei nicht schliessen"

#: ulng.rsmsgerrecreate
msgid "Cannot create file"
msgstr "Kann Datei nicht erstellen"

#: ulng.rsmsgerrendarchive
msgid "No more files in archive"
msgstr "Keine weiteren Dateien im Archiv"

#: ulng.rsmsgerreopen
msgid "Cannot open existing file"
msgstr "Kann bestehende Datei nicht öffnen"

#: ulng.rsmsgerreread
msgid "Error reading from file"
msgstr "Kann Datei nicht lesen"

#: ulng.rsmsgerrewrite
msgid "Error writing to file"
msgstr "Kann Datei nicht erstellen"

#: ulng.rsmsgerrforcedir
msgid "Can not create directory %s!"
msgstr "Verzeichnis %s kann nicht erstellt werden!"

#: ulng.rsmsgerrinvalidlink
msgid "Invalid link"
msgstr "Ungültige Verknüpfung"

#: ulng.rsmsgerrnofiles
msgid "No files found"
msgstr "Keine Dateien gefunden"

#: ulng.rsmsgerrnomemory
msgid "Not enough memory"
msgstr "Nicht genügend Arbeitsspeicher"

#: ulng.rsmsgerrnotsupported
msgid "Function not supported!"
msgstr "Funktion wird nicht unterstützt!"

#: ulng.rsmsgerrorincontextmenucommand
msgid "Error in context menu command"
msgstr "Fehler im Befehl des Kontextmenü"

#: ulng.rsmsgerrorloadingconfiguration
msgid "Error when loading configuration"
msgstr "Fehler beim Laden der Konfiguration"

#: ulng.rsmsgerrregexpsyntax
msgid "Syntax error in regular expression!"
msgstr "Syntaxfehler im regulären Ausdruck!"

#: ulng.rsmsgerrrename
msgid "Cannot rename file %s to %s"
msgstr "Kann Datei %s nicht zu %s umbenennen"

#: ulng.rsmsgerrsaveassociation
msgid "Can not save association!"
msgstr "Kann Verknüpfung nicht festlegen"

#: ulng.rsmsgerrsavefile
msgid "Cannot save file"
msgstr "Kann Datei nicht speichern"

#: ulng.rsmsgerrsetattribute
msgid "Can not set attributes for \"%s\""
msgstr "Kann Attribut für \"%s\" nicht setzen"

#: ulng.rsmsgerrsetdatetime
msgid "Can not set date/time for \"%s\""
msgstr "Kann Datum/Zeit für \"%s\" nicht setzen"

#: ulng.rsmsgerrsetownership
msgid "Can not set owner/group for \"%s\""
msgstr "Kann Besitzer/Gruppe für \"%s\" nicht erstellen"

#: ulng.rsmsgerrsetpermissions
msgid "Can not set permissions for \"%s\""
msgstr "Berechtigungen für \"%s\" können nicht gesetzt werden"

#: ulng.rsmsgerrsmallbuf
msgid "Buffer too small"
msgstr "Puffer zu klein"

#: ulng.rsmsgerrtoomanyfiles
msgid "Too many files to pack"
msgstr "Zuviel Dateien zum Packen"

#: ulng.rsmsgerrunknownformat
msgid "Archive format unknown"
msgstr "Archivformat unbekannt"

#: ulng.rsmsgfavoritetabsdeleteallentries
msgid "Are you sure you want to remove all entries of your Favorite Tabs? (There is no \"undo\" to this action!)"
msgstr "Wirklich alle Einträge vom Favoriten-Tab entfernen? (Es gibt keine Möglichkeit dies \"rückgängig\" zu machen!)"

#: ulng.rsmsgfavoritetabsdraghereentry
msgid "Drag here other entries"
msgstr "Andere Einträge hierher ziehen"

#: ulng.rsmsgfavoritetabsentername
msgid "Enter a name this Favorite Tabs entry"
msgstr "Namen für diesen Favoriten-Tab-Eintrag eingeben"

#: ulng.rsmsgfavoritetabsenternametitle
msgid "Saving a new Favorite Tabs entry"
msgstr "Speichere einen Favoriten-Tab-Eintrag"

#: ulng.rsmsgfavoritetabsexportedsuccessfully
msgid "Number of Favorite Tabs exported successfully: %d on %d"
msgstr "Anzahl der exportierten Favoriten-Tabs erfolgreich: %d in %d"

#: ulng.rsmsgfavoritetabsextramode
msgid "Default extra setting for save dir history for new Favorite Tabs:"
msgstr "Standard extra Einstellung für Verzeichnisverlauf für neue Favoriten-Tabs:"

#: ulng.rsmsgfavoritetabsimportedsuccessfully
msgid "Number of file(s) imported successfully: %d on %d"
msgstr "Anzahl der erfolgreich importierten Datei(en): %d auf %d"

#: ulng.rsmsgfavoritetabsimportsubmenuname
msgid "Legacy tabs imported"
msgstr "Veraltete importierte Tabs"

#: ulng.rsmsgfavoritetabsimporttitle
msgid "Select .tab file(s) to import (could be more than one at the time!)"
msgstr ".tab-Datei(en) zum Importieren auswählen (kann mehr als eine gleichzeitig sein!)"

#: ulng.rsmsgfavoritetabsmodifiednoimport
msgid "Last Favorite Tabs modification have been saved yet. Do you want to save them prior to continue?"
msgstr "Letzte Änderung der Favoriten-Tabs wurde noch nicht geändert. Vor dem Fortsetzen speichern?"

#: ulng.rsmsgfavoritetabssimplemode
msgctxt "ulng.rsmsgfavoritetabssimplemode"
msgid "Keep saving dir history with Favorite Tabs:"
msgstr "Verlauf weiter speichern mit Favoriten-Tabs:"

#: ulng.rsmsgfavoritetabssubmenuname
msgctxt "ulng.rsmsgfavoritetabssubmenuname"
msgid "Submenu name"
msgstr "Name des Untermenüs"

#: ulng.rsmsgfavoritetabsthiswillloadfavtabs
msgid "This will load the Favorite Tabs: \"%s\""
msgstr "Dies wird die Favoriten-Tabs \"%s\" laden"

#: ulng.rsmsgfavortietabssaveoverexisting
msgid "Save current tabs over existing Favorite Tabs entry"
msgstr "Aktuellen Tab oberhalb des bestehenden Favoriten-Tabs speichern"

#: ulng.rsmsgfilechangedsave
msgid "File %s changed, save?"
msgstr "Datei %s wurde geändert, speichern?"

#: ulng.rsmsgfileexistsfileinfo
msgid "%s bytes, %s"
msgstr "%s Bytes, %s"

#: ulng.rsmsgfileexistsoverwrite
msgid "Overwrite:"
msgstr "Überschreiben:"

#: ulng.rsmsgfileexistsrwrt
msgid "File %s exists, overwrite?"
msgstr "Datei %s existiert bereits. Überschreiben?"

#: ulng.rsmsgfileexistswithfile
msgid "With file:"
msgstr "Mit Datei:"

#: ulng.rsmsgfilenotfound
msgid "File \"%s\" not found."
msgstr "Datei \"%s\" nicht gefunden."

#: ulng.rsmsgfileoperationsactive
msgid "File operations active"
msgstr "Aktive Datei-Operationen"

#: ulng.rsmsgfileoperationsactivelong
msgid "Some file operations have not yet finished. Closing Double Commander may result in data loss."
msgstr "Es gibt Datei-Operationen, die noch nicht beendet sind. Das Schliessen von Double Commander kann deshalb zu Datenverlust führen!"

#: ulng.rsmsgfilepathovermaxpath
msgid ""
"The target name length (%d) is more than %d characters!\n"
"%s\n"
"Most programs will not be able to access a file/directory with such a long name!\n"
msgstr ""

#: ulng.rsmsgfilereadonly
msgid "File %s is marked as read-only/hidden/system. Delete it?"
msgstr "Datei %s ist als schreibgeschützt/versteckt/System markiert. Soll sie gelöscht werden?"

#: ulng.rsmsgfilesizetoobig
msgid "The file size of \"%s\" is too big for destination file system!"
msgstr "Die Größe der Datei \"%s\" ist zu groß für das Dateisystem des Ziel-Laufwerks!"

#: ulng.rsmsgfolderexistsrwrt
#, fuzzy
#| msgid "Folder %s exists, overwrite?"
msgid "Folder %s exists, merge?"
msgstr "Verzeichnis %s besteht bereits. Bitte eine Auswahl treffen:"

#: ulng.rsmsgfollowsymlink
msgid "Follow symlink \"%s\"?"
msgstr "Sym-Link \"%s\" folgen?"

#: ulng.rsmsgfortextformattoimport
msgid "Select the text format to import"
msgstr "Textformat zum Importieren auswählen"

#: ulng.rsmsghotdiraddselecteddirectories
msgid "Add %d selected dirs"
msgstr "Füge %d markierte Verzeichnisse hinzu"

#: ulng.rsmsghotdiraddselecteddirectory
msgid "Add selected dir: "
msgstr "Füge ausgewähltes Verzeichnis hinzu: "

#: ulng.rsmsghotdiraddthisdirectory
msgid "Add current dir: "
msgstr "Füge aktuelles Verzeichnis hinzu: "

#: ulng.rsmsghotdircommandname
msgid "Do command"
msgstr "Führe Befehl aus"

#: ulng.rsmsghotdircommandsample
msgid "cm_somthing"
msgstr ""

#: ulng.rsmsghotdirconfighotlist
msgctxt "ulng.rsmsghotdirconfighotlist"
msgid "Configuration of Directory Hotlist"
msgstr "Konfiguration der Verzeichnis-Hotlist"

#: ulng.rsmsghotdirdeleteallentries
msgid "Are you sure you want to remove all entries of your Directory Hotlist? (There is no \"undo\" to this action!)"
msgstr "Sicher, dass alle Einträge aus der Verzeichnis-Hotlist entfernt werden sollen? (Es gibt keine Möglichkeit dies \"rückgängig\" zu machen!)"

#: ulng.rsmsghotdirdemocommand
msgid "This will execute the following command:"
msgstr "Dies wird den folgenden Befehl ausführen:"

#: ulng.rsmsghotdirdemoname
msgid "This is hot dir named "
msgstr "So wird das Verzeichnis benannt"

#: ulng.rsmsghotdirdemopath
msgid "This will change active frame to the following path:"
msgstr "Dies wird den aktiven Rahmen in den folgenden Pfad ändern:"

#: ulng.rsmsghotdirdemotarget
msgid "And inactive frame would change to the following path:"
msgstr "Und der inaktive Rahmen wird in den folgenden Pfad geändert:"

#: ulng.rsmsghotdirerrorbackuping
msgid "Error backuping entries..."
msgstr "Fehler bei Sichern der Einträge..."

#: ulng.rsmsghotdirerrorexporting
msgid "Error exporting entries..."
msgstr "Fehler bei Export der Einträge..."

#: ulng.rsmsghotdirexportall
msgid "Export all!"
msgstr "Exportiere alle"

#: ulng.rsmsghotdirexporthotlist
msgid "Export Directory Hotlist - Select the entries you want to export"
msgstr "Exportiere Verzeichnis-Hotlist - Wähle Einträge die exportiert werden sollen"

#: ulng.rsmsghotdirexportsel
msgid "Export selected"
msgstr "Exportiere ausgewählte"

#: ulng.rsmsghotdirimportall
msgctxt "ulng.rsmsghotdirimportall"
msgid "Import all!"
msgstr "Alle importieren!"

#: ulng.rsmsghotdirimporthotlist
msgid "Import Directory Hotlist - Select the entries you want to import"
msgstr "Importiere Verzeichnis-Hotlist - Wähle die Einträge die importiert werden sollen"

#: ulng.rsmsghotdirimportsel
msgctxt "ulng.rsmsghotdirimportsel"
msgid "Import selected"
msgstr "Ausgewählte importieren"

#: ulng.rsmsghotdirjustpath
msgctxt "ulng.rsmsghotdirjustpath"
msgid "&Path:"
msgstr "Pfad"

#: ulng.rsmsghotdirlocatehotlistfile
msgid "Locate \".hotlist\" file to import"
msgstr "Finde \".hotlist\" Datei zum Importieren"

#: ulng.rsmsghotdirname
msgid "Hotdir name"
msgstr "Name für HotDir"

#: ulng.rsmsghotdirnbnewentries
msgid "Number of new entries: %d"
msgstr "Zahl neuer Einträge: %d"

#: ulng.rsmsghotdirnothingtoexport
msgid "Nothing selected to export!"
msgstr "Nichts zum Exportieren ausgewählt!"

#: ulng.rsmsghotdirpath
msgid "Hotdir path"
msgstr "HotDir-Pfad"

#: ulng.rsmsghotdirreaddselecteddirectory
msgid "Re-Add selected dir: "
msgstr "Gewähltes Verzeichnis erneut hinzufügen"

#: ulng.rsmsghotdirreaddthisdirectory
msgid "Re-Add current dir: "
msgstr "Aktuelles Verzeichnis erneut hinzufügen"

#: ulng.rsmsghotdirrestorewhat
msgid "Enter location and filename of Directory Hotlist to restore"
msgstr "Speicherort und Dateinamen der Verzeichnis-Hotlist eigeben, die wiederhergestellt werden soll"

#: ulng.rsmsghotdirsimplecommand
msgctxt "ulng.rsmsghotdirsimplecommand"
msgid "Command:"
msgstr "Befehl"

#: ulng.rsmsghotdirsimpleendofmenu
msgctxt "ulng.rsmsghotdirsimpleendofmenu"
msgid "(end of sub menu)"
msgstr "(Ende des Untermenüs)"

#: ulng.rsmsghotdirsimplemenu
msgctxt "ulng.rsmsghotdirsimplemenu"
msgid "Menu &name:"
msgstr "Name des Menüs"

#: ulng.rsmsghotdirsimplename
msgctxt "ulng.rsmsghotdirsimplename"
msgid "&Name:"
msgstr "Name:"

#: ulng.rsmsghotdirsimpleseparator
msgctxt "ulng.rsmsghotdirsimpleseparator"
msgid "(separator)"
msgstr "(Unterteilung)"

#: ulng.rsmsghotdirsubmenuname
msgctxt "ulng.rsmsghotdirsubmenuname"
msgid "Submenu name"
msgstr "Name des Untermenüs"

#: ulng.rsmsghotdirtarget
msgid "Hotdir target"
msgstr "Ziel der HotDir"

#: ulng.rsmsghotdirtiporderpath
msgid "Determine if you want the active frame to be sorted in a specified order after changing directory"
msgstr "Entscheidung ob der aktive Frame in einer bestimmten Weise sortiert werdensoll, nachdem das Verzeichnis gewechselt wurde"

#: ulng.rsmsghotdirtipordertarget
msgid "Determine if you want the not active frame to be sorted in a specified order after changing directory"
msgstr "Entscheide, ob der nicht-aktive Frame in einer bestimmten Art und Weise sortiert werden soll nach dem Wechsel des Verzeichnisses"

#: ulng.rsmsghotdirtipspecialdirbut
msgid "Some functions to select appropriate path relative, absolute, windows special folders, etc."
msgstr "Einige Funktionen zum Wählen eines relativen Pfades, absoluten Pfades, spezieler Ordner, etc."

#: ulng.rsmsghotdirtotalbackuped
msgid ""
"Total entries saved: %d\n"
"\n"
"Backup filename: %s\n"
msgstr ""
"Anzahl aller gespeicherter Einträge: %d\n"
"\n"
"Name des Backups: %s\n"

#: ulng.rsmsghotdirtotalexported
msgid "Total entries exported: "
msgstr "Gesamtzahl der exportierten Einträge"

#: ulng.rsmsghotdirwhattodelete
msgid ""
"Do you want to delete all elements inside the sub-menu [%s]?\n"
"Answering NO will delete only menu delimiters but will keep element inside sub-menu.\n"
msgstr ""
"Sollen alle Elemente innerhalb der Untermenüs gelöscht werden [%s]?\n"
"NEIN als Antwort löscht nur Unterteilungen innerhalb der Untermenüs, Elemente in den Untermenüs bleiben erhalten.\n"

#: ulng.rsmsghotdirwheretosave
msgid "Enter location and filename where to save a Directory Hotlist file"
msgstr "Speicherort und Dateiname zum Speichern der Verzeichnis-Hotlist"

#: ulng.rsmsgincorrectfilelength
msgid "Incorrect resulting filelength for file : \"%s\""
msgstr "Falsches Ergebnis der Dateilänge für: \"%s\""

#: ulng.rsmsginsertnextdisk
msgid ""
"Please insert next disk or something similar.\n"
"\n"
"It is to allow writing this file:\n"
"\"%s\"\n"
"\n"
"Number of bytes still to write: %d\n"
msgstr ""
"Bitte nächste Disk oder ähnliches einlegen.\n"
"\n"
"Damit diese Datei geschrieben werden kann:\n"
"\"%s\"\n"
"\n"
"Anzahl der noch zu schreibenden Bytes: %d\n"

#: ulng.rsmsginvalidcommandline
msgid "Error in command line"
msgstr "Fehler in der Befehlszeile"

#: ulng.rsmsginvalidfilename
msgid "Invalid filename"
msgstr "Ungültiger Dateiname"

#: ulng.rsmsginvalidformatofconfigurationfile
msgid "Invalid format of configuration file"
msgstr "Ungültiges Format der Konfigurationsdatei"

#: ulng.rsmsginvalidpath
msgid "Invalid path"
msgstr "Ungültiger Pfad"

#: ulng.rsmsginvalidpathlong
msgid "Path %s contains forbidden characters."
msgstr "Pfad %s enthält ungültige Zeichen."

#: ulng.rsmsginvalidplugin
msgid "This is not a valid plugin!"
msgstr "Dies ist kein akzeptables Plugin"

#: ulng.rsmsginvalidpluginarchitecture
msgid "This plugin is built for Double Commander for %s.%sIt can not work with Double Commander for %s!"
msgstr "Dieses Plugin wurde für Double Commander für %s erstellt.%sEs kann nicht für %s verwendet werden!"

#: ulng.rsmsginvalidquoting
msgid "Invalid quoting"
msgstr "Ungültiges Zitat"

#: ulng.rsmsginvalidselection
msgid "Invalid selection."
msgstr "Ungültige Auswahl"

#: ulng.rsmsgloadingfilelist
msgid "Loading file list..."
msgstr "Lade Dateiliste..."

#: ulng.rsmsglocatetcconfiguation
msgid "Locate TC configuration file (wincmd.ini)"
msgstr "TC-Konfigurationsdatei (wincmd.ini) finden"

#: ulng.rsmsglocatetcexecutable
msgid "Locate TC executable file (totalcmd.exe or totalcmd64.exe)"
msgstr "TC.exe (totalcmd.exe oder totalcmd64.exe) finden"

#: ulng.rsmsglogcopy
msgid "Copy file %s"
msgstr "Kopiere Datei %s"

#: ulng.rsmsglogdelete
msgid "Delete file %s"
msgstr "Lösche Datei %s"

#: ulng.rsmsglogerror
msgid "Error: "
msgstr "Fehler:"

#: ulng.rsmsglogextcmdlaunch
msgid "Launch external"
msgstr "Externen laden"

#: ulng.rsmsglogextcmdresult
msgid "Result external"
msgstr "Externes Ergebnis"

#: ulng.rsmsglogextract
msgid "Extract file %s"
msgstr "Entpacke Datei(en) %s"

#: ulng.rsmsgloginfo
msgid "Info: "
msgstr "Info"

#: ulng.rsmsgloglink
msgid "Create link %s"
msgstr "Erstelle Verknüpfung %s"

#: ulng.rsmsglogmkdir
msgid "Create directory %s"
msgstr "Erstelle Verzeichnis %s"

#: ulng.rsmsglogmove
msgid "Move file %s"
msgstr "Verschiebe Datei(en) %s"

#: ulng.rsmsglogpack
msgid "Pack to file %s"
msgstr "Packe in Datei %s"

#: ulng.rsmsglogrmdir
msgid "Remove directory %s"
msgstr "Verzeichnis %s entfernen"

#: ulng.rsmsglogsuccess
msgid "Done: "
msgstr "Fertig:"

#: ulng.rsmsglogsymlink
msgid "Create symlink %s"
msgstr "Erstelle symb. Link für %s"

#: ulng.rsmsglogtest
msgid "Test file integrity %s"
msgstr "Teste Dateiintegrität von %s"

#: ulng.rsmsglogwipe
msgid "Wipe file %s"
msgstr "Lösche Datei %s"

#: ulng.rsmsglogwipedir
msgid "Wipe directory %s"
msgstr "Lösche Verzeichnis %s"

#: ulng.rsmsgmasterpassword
msgid "Master Password"
msgstr "Master-Passwort"

#: ulng.rsmsgmasterpasswordenter
msgid "Please enter the master password:"
msgstr "Bitte Master-Passwort eingeben"

#: ulng.rsmsgnewfile
msgid "New file"
msgstr "Neue Datei"

#: ulng.rsmsgnextvolunpack
msgid "Next volume will be unpacked"
msgstr "Nächster Teil wird entpackt"

#: ulng.rsmsgnofiles
msgid "No files"
msgstr "Keine Dateien"

#: ulng.rsmsgnofilesselected
msgid "No files selected."
msgstr "Keine Dateien ausgewählt."

#: ulng.rsmsgnofreespacecont
msgid "No enough free space on target drive, Continue?"
msgstr "Nicht genügend Speicherplatz auf dem Ziellaufwerk. Trotzdem fortfahren?"

#: ulng.rsmsgnofreespaceretry
msgid "No enough free space on target drive, Retry?"
msgstr "Nicht genügend Speicherplatz auf dem Ziellaufwerk. Erneut versuchen?"

#: ulng.rsmsgnotdelete
msgid "Can not delete file %s"
msgstr "Kann Datei %s nicht löschen"

#: ulng.rsmsgnotimplemented
msgid "Not implemented."
msgstr "Nicht möglich."

#: ulng.rsmsgobjectnotexists
msgid "Object does not exist!"
msgstr ""

#: ulng.rsmsgpanelpreview
msgctxt "ulng.rsmsgpanelpreview"
msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings."
msgstr "Unten ist eine Vorschau zu sehen. Der Cursor kann bewegt werden und Dateien markiert werden um einen Eindruck von den verschiedenen Einstellungen zu bekommen."

#: ulng.rsmsgpassword
msgid "Password:"
msgstr "Passwort:"

#: ulng.rsmsgpassworddiff
msgid "Passwords are different!"
msgstr "Die zwei Passwort-Eingaben stimmen nicht überein!"

#: ulng.rsmsgpasswordenter
msgid "Please enter the password:"
msgstr "Bitte Passwort eingeben:"

#: ulng.rsmsgpasswordfirewall
msgid "Password (Firewall):"
msgstr "Passwort (Firewall):"

#: ulng.rsmsgpasswordverify
msgid "Please re-enter the password for verification:"
msgstr "Bitte das Passwort zum Verifizieren erneut eingeben!"

#: ulng.rsmsgpopuphotdelete
msgid "&Delete %s"
msgstr "&Lösche %s"

#: ulng.rsmsgpresetalreadyexists
msgid "Preset \"%s\" already exists. Overwrite?"
msgstr "Voreinstellung \"%s\" besteht bereits. Überschreiben?"

#: ulng.rsmsgproblemexecutingcommand
msgid "Problem executing command (%s)"
msgstr "Problem beim Ausführen des Befehls (%s)"

#: ulng.rsmsgpromptaskingfilename
msgid "Filename for dropped text:"
msgstr "Dateiname für gezogenen Text:"

#: ulng.rsmsgprovidethisfile
msgid "Please, make this file available. Retry?"
msgstr "Bitte diese Datei zur Verfügung stellen. Nochmal versuchen?"

#: ulng.rsmsgrenamefavtabs
msgid "Enter new friendly name for this Favorite Tabs"
msgstr "Neuen guten Namen für diesen Favoriten-Tab eingeben"

#: ulng.rsmsgrenamefavtabsmenu
msgid "Enter new name for this menu"
msgstr "Neuen Namen für dieses Menü eingeben"

#: ulng.rsmsgrenfldr
msgid "Rename/move %d selected files/directories?"
msgstr "%d markierte Dateien/Verzeichnisse umbenennen/verschieben?"

#: ulng.rsmsgrensel
msgid "Rename/move selected \"%s\"?"
msgstr "Datei/Verzeichnis \"%s\" kopieren/verschieben?"

#: ulng.rsmsgrestartforapplychanges
msgid "Please, restart Double Commander in order to apply changes"
msgstr "Bitte Double Commander neustarten um die Änderungen zu übernehmen"

#: ulng.rsmsgsekectfiletype
msgid "Select to which file type to add extension \"%s\""
msgstr "Bitte angeben welcher Dateityp die Endung \"%s\" bekommen soll"

#: ulng.rsmsgselectedinfo
msgid "Selected: %s of %s, files: %d of %d, folders: %d of %d"
msgstr "Ausgewählt: %s von %s, Dateien: %d von %d, Verzeichnisse: %d von %d"

#: ulng.rsmsgselectexecutablefile
msgid "Select executable file for"
msgstr "Ausführbare Datei auswählen"

#: ulng.rsmsgselectonlychecksumfiles
msgid "Please select only checksum files!"
msgstr "Bitte nur Prüfsummen-Dateien auswählen!"

#: ulng.rsmsgsellocnextvol
msgid "Please select location of next volume"
msgstr "Speicherort des nächsten Teils angeben"

#: ulng.rsmsgsetvolumelabel
msgid "Set volume label"
msgstr "Laufwerksbezeichnung angeben"

#: ulng.rsmsgspecialdir
msgid "Special Dirs"
msgstr "Besondere Verzeichnisse"

#: ulng.rsmsgspecialdiraddacti
msgid "Add path from active frame"
msgstr "Pfad aus dem aktiven Frame hinzufügen"

#: ulng.rsmsgspecialdiraddnonacti
msgid "Add path from inactive frame"
msgstr "Pfad aus dem inaktiven Frame hinzufügen"

#: ulng.rsmsgspecialdirbrowssel
msgid "Browse and use selected path"
msgstr "Durchsuche und benutze den gewählten Pfad"

#: ulng.rsmsgspecialdirenvvar
msgid "Use environment variable..."
msgstr "Benutze Umgebungsvariable..."

#: ulng.rsmsgspecialdirgotodc
msgid "Go to Double Commander special path..."
msgstr "Gehe zu besonderem Double Commander Pfad..."

#: ulng.rsmsgspecialdirgotoenvvar
msgid "Go to environment variable..."
msgstr "Gehe zu Umgebungsvariable..."

#: ulng.rsmsgspecialdirgotoother
msgid "Go to other Windows special folder..."
msgstr "Gehe zu anderem besonderen Windows-Pfad..."

#: ulng.rsmsgspecialdirgototc
msgid "Go to Windows special folder (TC)..."
msgstr "Gehe zu besonderem Windows-Verzeichnis (TC)"

#: ulng.rsmsgspecialdirmakereltohotdir
msgid "Make relative to hotdir path"
msgstr "Relativ zum HotDir-Pfad machen"

#: ulng.rsmsgspecialdirmkabso
msgid "Make path absolute"
msgstr "Mache Pfad absolut"

#: ulng.rsmsgspecialdirmkdcrel
msgid "Make relative to Double Commander special path..."
msgstr "Mache Pfad relativ zu Double Commander..."

#: ulng.rsmsgspecialdirmkenvrel
msgid "Make relative to environment variable..."
msgstr "Mache Pfad relativ zur Umgebungsvariable..."

#: ulng.rsmsgspecialdirmktctel
msgid "Make relative to Windows special folder (TC)..."
msgstr "Mache Pfad relativ zum besonderen Windows-Verzeichnis (TC)..."

#: ulng.rsmsgspecialdirmkwnrel
msgid "Make relative to other Windows special folder..."
msgstr "Mache Pfda relativ zu anderem besonderen Windows-Verzeichnis..."

#: ulng.rsmsgspecialdirusedc
msgid "Use Double Commander special path..."
msgstr "Nutze besonderen Double Commander-Pfad..."

#: ulng.rsmsgspecialdirusehotdir
msgid "Use hotdir path"
msgstr "Nutze HotDir-Pfad"

#: ulng.rsmsgspecialdiruseother
msgid "Use other Windows special folder..."
msgstr "Nutze anderes besonderes Windows-Verzeichnis..."

#: ulng.rsmsgspecialdirusetc
msgid "Use Windows special folder (TC)..."
msgstr "Nutze besonderes Windows-Verzeichnis (TC)..."

#: ulng.rsmsgtabforopeninginnewtab
msgid "This tab (%s) is locked! Open directory in another tab?"
msgstr "Dieser Tab (%s) ist gesperrt! Verzeichnis in anderem Tab öffnen?"

#: ulng.rsmsgtabrenamecaption
msgid "Rename tab"
msgstr "Tab umbenennen"

#: ulng.rsmsgtabrenameprompt
msgid "New tab name:"
msgstr "Neuer Tab-Name"

#: ulng.rsmsgtargetdir
msgid "Target path:"
msgstr "Zielpfad"

#: ulng.rsmsgtcconfignotfound
msgid ""
"Error! Cannot find the TC configuration file:\n"
"%s\n"
msgstr ""
"Fehler! Kann die TC-Konfigurationsdatei nicht finden:\n"
"%s\n"

#: ulng.rsmsgtcexecutablenotfound
msgid ""
"Error! Cannot find the TC configuration executable:\n"
"%s\n"
msgstr ""
"Fehler! Die ausführbare Datei für die TC-Konfiguration kann nicht gefunden werden:\n"
"%s\n"

#: ulng.rsmsgtcisrunning
msgid ""
"Error! TC is still running but it should be closed for this operation.\n"
"Close it and press OK or press CANCEL to abort.\n"
msgstr ""
"Fehler! TC läuft noch, sollte aber für diese Aktion geschlossen werden.\n"
"Bitte schließen und OK klicken oder ABBRUCH zum abbrechen.\n"

#: ulng.rsmsgtctoolbarnotfound
msgid ""
"Error! Cannot find the desired wanted TC toolbar output folder:\n"
"%s\n"
msgstr ""
"Fehler! Kann den angegebenen gewünschten TC-Toolbar Ausgabeordner nicht finden:\n"
"%s\n"

#: ulng.rsmsgtctoolbarwheretosave
msgid "Enter location and filename where to save a TC Toolbar file"
msgstr "Speicherort und Datinamen angeben unter dem die TC-Toolbardatei gespeichert werden soll"

#: ulng.rsmsgthisisnowinclipboard
msgid "\"%s\" is now in the clipboard"
msgstr "\"%s\" ist jetzt in der Zwischenablage"

#: ulng.rsmsgtitleextnotinfiletype
msgid "Extension of selected file is not in any recognized file types"
msgstr "Endung der gewählten Datei gehört nicht zu den bekannten Dateitypen"

#: ulng.rsmsgtoolbarlocatedctoolbarfile
msgid "Locate \".toolbar\" file to import"
msgstr "\".toolbar\"-Datei angeben zum Importieren"

#: ulng.rsmsgtoolbarlocatetctoolbarfile
msgid "Locate \".BAR\" file to import"
msgstr "\".BAR\"-Datei angeben zum Importieren"

#: ulng.rsmsgtoolbarrestorewhat
msgid "Enter location and filename of Toolbar to restore"
msgstr "Speicherort und Dateinamen der Toolbar zum Wiederherstellen angeben"

#: ulng.rsmsgtoolbarsaved
msgid ""
"Saved!\n"
"Toolbar filename: %s\n"
msgstr ""
"Gespeichert!\n"
"Name der Toolbar: %s\n"

#: ulng.rsmsgtoomanyfilesselected
msgid "Too many files selected."
msgstr "Zuviele Dateien ausgewählt."

#: ulng.rsmsgundeterminednumberoffile
msgid "Undetermined"
msgstr "Unbestimmt"

#: ulng.rsmsgunexpectedusagetreeviewmenu
msgid "ERROR: Unexpected Tree View Menu usage!"
msgstr ""

#: ulng.rsmsgurl
msgid "URL:"
msgstr ""

#: ulng.rsmsguserdidnotsetextension
msgid "<NO EXT>"
msgstr ""

#: ulng.rsmsguserdidnotsetname
msgid "<NO NAME>"
msgstr ""

#: ulng.rsmsgusername
msgid "User name:"
msgstr "Nutzername:"

#: ulng.rsmsgusernamefirewall
msgid "User name (Firewall):"
msgstr "Nutzername (Firewall):"

#: ulng.rsmsgverify
msgid "VERIFICATION:"
msgstr ""

#: ulng.rsmsgverifywrong
msgid "The target file is corrupted, checksum mismatch!"
msgstr ""

#: ulng.rsmsgvolumelabel
msgid "Volume label:"
msgstr "Laufwerksbezeichnung:"

#: ulng.rsmsgvolumesizeenter
msgid "Please enter the volume size:"
msgstr "Bitte Volume-Größe eingeben:"

#: ulng.rsmsgwipefldr
msgid "Wipe %d selected files/directories?"
msgstr "%d markierte Dateien/Ordner sicher löschen?"

#: ulng.rsmsgwipesel
msgid "Wipe selected \"%s\"?"
msgstr "Markierte \"%s\" sicher löschen?"

#: ulng.rsmsgwithactionwith
msgid "with"
msgstr "mit"

#: ulng.rsmulrenautorename
msgid "Do auto-rename to \"name (1).ext\", \"name (2).ext\" etc.?"
msgstr ""

#: ulng.rsmulrenfilenamestylelist
msgid "No change;UPPERCASE;lowercase;First char uppercase;First Char Of Every Word Uppercase;"
msgstr "Keine Änderung;GROSSBUCHSTABEN;alles klein;Erster Buchstabe groß;Erster Buchstabe in jedem Wort groß;"

#: ulng.rsmulrenwarningduplicate
msgid "Warning, duplicate names!"
msgstr ""

#: ulng.rsmulrenwronglinesnumber
msgid "File contains wrong number of lines: %d, should be %d!"
msgstr ""

#: ulng.rsnewsearchclearfilteroptions
msgid "Keep;Clear;Prompt"
msgstr "erhalten;leeren;fragen"

#: ulng.rsnoequivalentinternalcommand
msgid "No internal equivalent command"
msgstr ""

#: ulng.rsnofindfileswindowyet
msgid "Sorry, no \"Find files\" window yet..."
msgstr ""

#: ulng.rsnootherfindfileswindowtoclose
msgid "Sorry, no other \"Find files\" window to close and free from memory..."
msgstr ""

#: ulng.rsoperaborted
msgid "Aborted"
msgstr "Abgebrochen"

#: ulng.rsopercalculatingchecksum
msgid "Calculating checksum"
msgstr "Berechne Prüfsumme"

#: ulng.rsopercalculatingchecksumin
msgid "Calculating checksum in \"%s\""
msgstr "Berechne Prüfsumme in \"%s\""

#: ulng.rsopercalculatingchecksumof
msgid "Calculating checksum of \"%s\""
msgstr "Berechne Prüfsumme von \"%s\""

#: ulng.rsopercalculatingstatictics
msgctxt "ulng.rsopercalculatingstatictics"
msgid "Calculating"
msgstr "Berechne"

#: ulng.rsopercalculatingstatisticsin
msgid "Calculating \"%s\""
msgstr "Berechne \"%s\""

#: ulng.rsopercombining
msgid "Joining"
msgstr "Verschmelze"

#: ulng.rsopercombiningfromto
msgid "Joining files in \"%s\" to \"%s\""
msgstr "Verschmelze Dateien in \"%s\" nach\"%s\""

#: ulng.rsopercopying
msgid "Copying"
msgstr "Kopiere"

#: ulng.rsopercopyingfromto
msgid "Copying from \"%s\" to \"%s\""
msgstr "Kopiere von \"%s\" nach \"%s\""

#: ulng.rsopercopyingsomethingto
msgid "Copying \"%s\" to \"%s\""
msgstr "Kopiere \"%s\" nach \"%s\""

#: ulng.rsopercreatingdirectory
msgid "Creating directory"
msgstr "Erstelle Verzeichnis"

#: ulng.rsopercreatingsomedirectory
msgid "Creating directory \"%s\""
msgstr "Erstelle Verzeichnis \"%s\""

#: ulng.rsoperdeleting
msgctxt "ulng.rsoperdeleting"
msgid "Deleting"
msgstr "Lösche"

#: ulng.rsoperdeletingin
msgid "Deleting in \"%s\""
msgstr "Lösche in \"%s\""

#: ulng.rsoperdeletingsomething
msgid "Deleting \"%s\""
msgstr "Lösche \"%s\""

#: ulng.rsoperexecuting
msgid "Executing"
msgstr "Führe aus"

#: ulng.rsoperexecutingsomething
msgid "Executing \"%s\""
msgstr "Führe \"%s\" aus"

#: ulng.rsoperextracting
msgid "Extracting"
msgstr "Entpacke"

#: ulng.rsoperextractingfromto
msgid "Extracting from \"%s\" to \"%s\""
msgstr "Entpacke von \"%s\" nach \"%s\""

#: ulng.rsoperfinished
msgid "Finished"
msgstr "Beendet"

#: ulng.rsoperlisting
msgid "Listing"
msgstr "Liste auf"

#: ulng.rsoperlistingin
msgid "Listing \"%s\""
msgstr "Liste \"%s\" auf"

#: ulng.rsopermoving
msgid "Moving"
msgstr "Verschiebe"

#: ulng.rsopermovingfromto
msgid "Moving from \"%s\" to \"%s\""
msgstr "Verschiebe von \"%s\" nach \"%s\""

#: ulng.rsopermovingsomethingto
msgid "Moving \"%s\" to \"%s\""
msgstr "Verschiebe \"%s\" nach \"%s\""

#: ulng.rsopernotstarted
msgid "Not started"
msgstr "Nicht gestartet"

#: ulng.rsoperpacking
msgid "Packing"
msgstr "Packe"

#: ulng.rsoperpackingfromto
msgid "Packing from \"%s\" to \"%s\""
msgstr "Packe von \"%s\" nach \"%s\""

#: ulng.rsoperpackingsomethingto
msgid "Packing \"%s\" to \"%s\""
msgstr "Packe \"%s\" nach \"%s\""

#: ulng.rsoperpaused
msgid "Paused"
msgstr "Pausiert"

#: ulng.rsoperpausing
msgid "Pausing"
msgstr "Pause"

#: ulng.rsoperrunning
msgid "Running"
msgstr "Wird ausgeführt"

#: ulng.rsopersettingproperty
msgid "Setting property"
msgstr "Stelle Eigenschaften ein"

#: ulng.rsopersettingpropertyin
msgid "Setting property in \"%s\""
msgstr "Setze Eigenschaften in \"%s\""

#: ulng.rsopersettingpropertyof
msgid "Setting property of \"%s\""
msgstr "Setze Eigenschaft von \"%s\""

#: ulng.rsopersplitting
msgid "Splitting"
msgstr "Teile"

#: ulng.rsopersplittingfromto
msgid "Splitting \"%s\" to \"%s\""
msgstr "Teile \"%s\" nach \"%s\""

#: ulng.rsoperstarting
msgid "Starting"
msgstr "Wird gestartet"

#: ulng.rsoperstopped
msgid "Stopped"
msgstr "Gestoppt"

#: ulng.rsoperstopping
msgid "Stopping"
msgstr "Stoppe"

#: ulng.rsopertesting
msgid "Testing"
msgstr "Test"

#: ulng.rsopertestingin
msgid "Testing in \"%s\""
msgstr "Teste in \"%s\""

#: ulng.rsopertestingsomething
msgid "Testing \"%s\""
msgstr "Teste \"%s\""

#: ulng.rsoperverifyingchecksum
msgid "Verifying checksum"
msgstr "Verifiziere Prüfsumme"

#: ulng.rsoperverifyingchecksumin
msgid "Verifying checksum in \"%s\""
msgstr "Verifiziere Prüfsumme in \"%s\""

#: ulng.rsoperverifyingchecksumof
msgid "Verifying checksum of \"%s\""
msgstr "Verifiziere Prüfsumme von \"%s\""

#: ulng.rsoperwaitingforconnection
msgid "Waiting for access to file source"
msgstr "Warte auf Zugriff auf Datei-Quelle"

#: ulng.rsoperwaitingforfeedback
msgid "Waiting for user response"
msgstr "Warte auf Benutzereingabe"

#: ulng.rsoperwiping
msgid "Wiping"
msgstr "Lösche sicher"

#: ulng.rsoperwipingin
msgid "Wiping in \"%s\""
msgstr "Lösche sicher in \"%s\""

#: ulng.rsoperwipingsomething
msgid "Wiping \"%s\""
msgstr "Lösche \"%s\" sicher"

#: ulng.rsoperworking
msgid "Working"
msgstr "Führe aus"

#: ulng.rsoptaddfrommainpanel
msgid "Add at &beginning;Add at the end;Smart add"
msgstr "Am Anfang anfügen;Am Ende anfügen;Smart hinzufügen"

#: ulng.rsoptarchivedelete
msgctxt "ulng.rsoptarchivedelete"
msgid "Delete:"
msgstr "Lösche:"

#: ulng.rsoptarchiveextractwithoutpath
msgid "Extract without path:"
msgstr "Ohne gespeicherten Pfad entpacken:"

#: ulng.rsoptarchiveformmode
msgid "Format parsing mode:"
msgstr "Format Analyse-Modus:"

#: ulng.rsoptarchiveid
msgctxt "ulng.rsoptarchiveid"
msgid "ID:"
msgstr ""

#: ulng.rsoptarchiveidpos
msgctxt "ulng.rsoptarchiveidpos"
msgid "ID Position:"
msgstr ""

#: ulng.rsoptarchiveidseekrange
msgid "ID Seek Range:"
msgstr "ID Such-Bereich:"

#: ulng.rsoptarchiveparam
msgid "Parameter"
msgstr "Parameter"

#: ulng.rsoptarchivepasswordquery
msgid "Password query string:"
msgstr "Passwortabfrage:"

#: ulng.rsoptarchiveselfextract
msgctxt "ulng.rsoptarchiveselfextract"
msgid "Create self extracting archive:"
msgstr "Selbstentpackendes Archiv (Sfx) erstellen:"

#: ulng.rsoptarchivetest
msgctxt "ulng.rsoptarchivetest"
msgid "Test:"
msgstr "Teste:"

#: ulng.rsoptarchivetypename
msgid "Archive type name:"
msgstr "Name des Archiv-Typs:"

#: ulng.rsoptarchivevalue
msgctxt "ulng.rsoptarchivevalue"
msgid "Value"
msgstr "Wert"

#: ulng.rsoptassocpluginwith
msgid "Associate plugin \"%s\" with:"
msgstr "Verknüpfe PlugIn \"%s\" mit:"

#: ulng.rsoptautosizecolumn
msgid "First;Last;"
msgstr "Erste;Letzte;"

#: ulng.rsoptconfigsortorder
msgid "Classic, legacy order;Alphabetic order (but language still first)"
msgstr "Klassisch, Vermächtnis-Reihenfolge, Alphabetische Reihenfolge (aber Sprache immer zuerst)"

#: ulng.rsoptdifferframeposition
msgid "Active frame panel on left, inactive on right (legacy);Left frame panel on left, right on right"
msgstr "Aktiver Frame-Panel links, inaktiver rechts (Vermächtnis);Linker Frame-Panel links, rechts auf der rechten Seite"

#: ulng.rsoptdisable
msgid "Disable"
msgstr "Deaktivieren"

#: ulng.rsoptenable
msgctxt "ulng.rsoptenable"
msgid "Enable"
msgstr "Aktivieren"

#: ulng.rsoptenterext
msgid "Enter extension"
msgstr "Endung eingeben"

#: ulng.rsoptfavoritetabswheretoaddinlist
msgid "Add at beginning;Add at the end;Alphabetical sort"
msgstr "Am Anfang hinzufügen;Am Ende hinzufügen;Alphabetisch sortieren"

#: ulng.rsoptfileoperationsprogresskind
msgid "separate window;minimized separate window;operations panel"
msgstr "eigenes Fenster;minimiertes eigenes Fenster;Operationsfenster"

#: ulng.rsoptfilesizeformat
msgid "float;B;K;M;G"
msgstr ""

#: ulng.rsopthotkeysadddeleteshortcutlong
msgid "Shortcut %s for cm_Delete will be registered, so it can be used to reverse this setting."
msgstr "Tastaturkürzel %s für cm_delete wird registriert, damit die Änderung rückgängig gemacht werden kann."

#: ulng.rsopthotkeysaddhotkey
msgid "Add hotkey for %s"
msgstr "Füge Tastaturkürzel für %s hinzu"

#: ulng.rsopthotkeysaddshortcutbutton
msgid "Add shortcut"
msgstr "Tastaturkürzel erstellen"

#: ulng.rsopthotkeyscannotsetshortcut
msgid "Cannot set shortcut"
msgstr "Kann die Verknüpfung nicht erstellen"

#: ulng.rsopthotkeyschangeshortcut
msgid "Change shortcut"
msgstr "Verknüpfung ändern"

#: ulng.rsopthotkeyscommand
msgctxt "ulng.rsopthotkeyscommand"
msgid "Command"
msgstr "Befehle"

#: ulng.rsopthotkeysdeletetrashcanoverrides
msgid "Shortcut %s for cm_Delete has a parameter that overrides this setting. Do you want to change this parameter to use the global setting?"
msgstr "Verknüpfung %s für cm_Delete hat Parameter, die diese Einstellung überschreiben. Soll dieser Parameter geändert werden, um die globale Einstellung zu verwenden?"

#: ulng.rsopthotkeysdeletetrashcanparameterexists
msgid "Shortcut %s for cm_Delete needs to have a parameter changed to match shortcut %s. Do you want to change it?"
msgstr "Verknüpfung %s für cm_Delete muss einen Parameter geändert bekommen, um der Verknüpfung %s zu entsprechen. Soll der Parameter geändert werden?"

#: ulng.rsopthotkeysdescription
msgctxt "ulng.rsopthotkeysdescription"
msgid "Description"
msgstr "Beschreibung"

#: ulng.rsopthotkeysedithotkey
msgid "Edit hotkey for %s"
msgstr "Bearbeite Tastaturkürzel für %s"

#: ulng.rsopthotkeysfixparameter
msgid "Fix parameter"
msgstr "Parameter wiederherstellen"

#: ulng.rsopthotkeyshotkey
msgctxt "ulng.rsopthotkeyshotkey"
msgid "Hotkey"
msgstr "Tastaturkürzel"

#: ulng.rsopthotkeyshotkeys
msgctxt "ulng.rsopthotkeyshotkeys"
msgid "Hotkeys"
msgstr "Tastaturkürzel"

#: ulng.rsopthotkeysnohotkey
msgid "<none>"
msgstr "<leer>"

#: ulng.rsopthotkeysparameters
msgctxt "ulng.rsopthotkeysparameters"
msgid "Parameters"
msgstr "Parameter"

#: ulng.rsopthotkeyssetdeleteshortcut
msgid "Set shortcut to delete file"
msgstr "Verknüpfung festlegen um Dateien zu löschen"

#: ulng.rsopthotkeysshortcutfordeletealreadyassigned
msgid "For this setting to work with shortcut %s, shortcut %s must be assigned to cm_Delete but it is already assigned to %s. Do you want to change it?"
msgstr "Damit diese Einstellung mit Verknüpfung %s funktioniert, muss %s cm_Delete zugewiesen werden, aber ist %s zugewiesen. Soll dies geändert werden?"

#: ulng.rsopthotkeysshortcutfordeleteissequence
msgid "Shortcut %s for cm_Delete is a sequence shortcut for which a hotkey with reversed Shift cannot be assigned. This setting might not work."
msgstr "Verknüpfung %s für cm_Delete ist eine Sequenz-Verknüpfung, für die ein Tastaturkürzel mit umgekehrter Umschalt-Taste nicht verwendet werden kann. Die Einstellung funktioniert wahrscheinlich so nicht."

#: ulng.rsopthotkeysshortcutused
msgid "Shortcut in use"
msgstr "Tastaturkürzel in Gebrauch"

#: ulng.rsopthotkeysshortcutusedtext1
msgid "Shortcut %s is already used."
msgstr "Tastaturkürzel %s wird bereits verwendet."

#: ulng.rsopthotkeysshortcutusedtext2
msgid "Change it to %s?"
msgstr "Verändern zu %s?"

#: ulng.rsopthotkeysusedby
msgid "used for %s in %s"
msgstr "Benutzt für %s in %s"

#: ulng.rsopthotkeysusedwithdifferentparams
msgid "used for this command but with different parameters"
msgstr "für diesen Befehl genutzt, aber mit unterschiedlichen Parametern"

#: ulng.rsoptionseditorarchivers
msgctxt "ulng.rsoptionseditorarchivers"
msgid "Archivers"
msgstr "Archivierer"

#: ulng.rsoptionseditorautorefresh
msgctxt "ulng.rsoptionseditorautorefresh"
msgid "Auto refresh"
msgstr "Automatisch auffrischen"

#: ulng.rsoptionseditorbehavior
msgctxt "ulng.rsoptionseditorbehavior"
msgid "Behaviors"
msgstr "Verhalten"

#: ulng.rsoptionseditorbriefview
msgctxt "ulng.rsoptionseditorbriefview"
msgid "Brief"
msgstr "Verkürzt"

#: ulng.rsoptionseditorcolors
msgctxt "ulng.rsoptionseditorcolors"
msgid "Colors"
msgstr "Farben"

#: ulng.rsoptionseditorcolumnsview
msgid "Columns"
msgstr "Spalten"

#: ulng.rsoptionseditorconfiguration
msgctxt "ulng.rsoptionseditorconfiguration"
msgid "Configuration"
msgstr "Einstellungen"

#: ulng.rsoptionseditorcustomcolumns
msgid "Custom columns"
msgstr "Benutzerdefinierte Spalten"

#: ulng.rsoptionseditordirectoryhotlist
msgctxt "ulng.rsoptionseditordirectoryhotlist"
msgid "Directory Hotlist"
msgstr "Verzeichnisfavoriten"

#: ulng.rsoptionseditordraganddrop
msgid "Drag & drop"
msgstr "Drag & Drop (ziehen und ablegen)"

#: ulng.rsoptionseditordriveslistbutton
msgid "Drives list button"
msgstr "Button für das Laufwerks-Drop-down-Menü"

#: ulng.rsoptionseditorfavoritetabs
msgid "Favorite Tabs"
msgstr "Favoriten-Tabs"

#: ulng.rsoptionseditorfileassicextra
msgid "File associations extra"
msgstr "Extra Optionen für Dateiverknüpfungen"

#: ulng.rsoptionseditorfileassoc
msgctxt "ulng.rsoptionseditorfileassoc"
msgid "File associations"
msgstr "Dateiverknüpfungen"

#: ulng.rsoptionseditorfilenewfiletypes
#, fuzzy
msgctxt "ulng.rsoptionseditorfilenewfiletypes"
msgid "New"
msgstr "Neu"

#: ulng.rsoptionseditorfileoperations
msgctxt "ulng.rsoptionseditorfileoperations"
msgid "File operations"
msgstr "Dateioperationen"

#: ulng.rsoptionseditorfilepanels
msgctxt "ulng.rsoptionseditorfilepanels"
msgid "File panels"
msgstr "Dateifenster"

#: ulng.rsoptionseditorfilesearch
msgctxt "ulng.rsoptionseditorfilesearch"
msgid "File search"
msgstr "Dateien suchen"

#: ulng.rsoptionseditorfilesviews
msgid "Files views"
msgstr "Datei-Ansicht"

#: ulng.rsoptionseditorfiletypes
msgctxt "ulng.rsoptionseditorfiletypes"
msgid "File types"
msgstr "Dateitypen"

#: ulng.rsoptionseditorfoldertabs
msgctxt "ulng.rsoptionseditorfoldertabs"
msgid "Folder tabs"
msgstr "Verzeichnis-Tabs"

#: ulng.rsoptionseditorfoldertabsextra
msgid "Folder tabs extra"
msgstr "Favoriten-Tabs extra"

#: ulng.rsoptionseditorfonts
msgctxt "ulng.rsoptionseditorfonts"
msgid "Fonts"
msgstr "Schriftarten"

#: ulng.rsoptionseditorhighlighters
msgid "Highlighters"
msgstr "Hervorheber"

#: ulng.rsoptionseditorhotkeys
msgctxt "ulng.rsoptionseditorhotkeys"
msgid "Hot keys"
msgstr "Tastaturkürzel"

#: ulng.rsoptionseditoricons
msgctxt "ulng.rsoptionseditoricons"
msgid "Icons"
msgstr "Icons"

#: ulng.rsoptionseditorignorelist
msgctxt "ulng.rsoptionseditorignorelist"
msgid "Ignore list"
msgstr "Ausschlussliste"

#: ulng.rsoptionseditorkeyboard
msgid "Keys"
msgstr "Tasten"

#: ulng.rsoptionseditorlanguage
msgctxt "ulng.rsoptionseditorlanguage"
msgid "Language"
msgstr "Sprache"

#: ulng.rsoptionseditorlayout
msgctxt "ulng.rsoptionseditorlayout"
msgid "Layout"
msgstr "Layout"

#: ulng.rsoptionseditorlog
msgctxt "ulng.rsoptionseditorlog"
msgid "Log"
msgstr "Log"

#: ulng.rsoptionseditormiscellaneous
msgctxt "ulng.rsoptionseditormiscellaneous"
msgid "Miscellaneous"
msgstr "Verschiedenes"

#: ulng.rsoptionseditormouse
msgid "Mouse"
msgstr "Maus"

#: ulng.rsoptionseditoroptionschanged
msgid ""
"Options have changed in \"%s\"\n"
"\n"
"Do you want to save modifications?\n"
msgstr ""

#: ulng.rsoptionseditorplugins
msgctxt "ulng.rsoptionseditorplugins"
msgid "Plugins"
msgstr "Plugins"

#: ulng.rsoptionseditorquicksearch
msgctxt "ulng.rsoptionseditorquicksearch"
msgid "Quick search/filter"
msgstr "Schnelle Suche/Filter"

#: ulng.rsoptionseditorterminal
msgctxt "ulng.rsoptionseditorterminal"
msgid "Terminal"
msgstr "Befehlszeilen-Interpreter"

#: ulng.rsoptionseditortoolbar
msgid "Toolbar"
msgstr "Werkzeugleiste"

#: ulng.rsoptionseditortools
msgctxt "ulng.rsoptionseditortools"
msgid "Tools"
msgstr "Tools"

#: ulng.rsoptionseditortooltips
msgctxt "ulng.rsoptionseditortooltips"
msgid "Tooltips"
msgstr "Tooltips"

#: ulng.rsoptionseditortreeviewmenu
msgctxt "ulng.rsoptionseditortreeviewmenu"
msgid "Tree View Menu"
msgstr "Menü Baumansicht"

#: ulng.rsoptionseditortreeviewmenucolors
msgid "Tree View Menu Colors"
msgstr "Farben Menü Baumansicht"

#: ulng.rsoptletters
msgid "None;Command Line;Quick Search;Quick Filter"
msgstr "Kein;Befehlszeile;Schnellsuche;Schnellfilter"

#: ulng.rsoptmouseselectionbutton
msgid "Left button;Right button;"
msgstr "Linke Taste;Rechte Taste;"

#: ulng.rsoptnewfilesposition
msgid "at the top of the file list;after directories (if directories are sorted before files);at sorted position;at the bottom of the file list"
msgstr "an den Beginn der Dateiliste;hinter die Verzeichnisse (wenn Verzeichnisse vor Dateien sortiert werden sollen);an festgelegte Position;ans Ende der Dateiliste"

#: ulng.rsoptpluginalreadyassigned
msgid "Plugin %s is already assigned for the following extensions:"
msgstr "Plugin %s ist bereits den folgenden Dateiendungen zugewiesen:"

#: ulng.rsoptpluginsactive
msgctxt "ulng.rsoptpluginsactive"
msgid "Active"
msgstr "Aktiv"

#: ulng.rsoptpluginsfilename
msgctxt "ulng.rsoptpluginsfilename"
msgid "File name"
msgstr "Dateiname"

#: ulng.rsoptpluginsname
msgctxt "ulng.rsoptpluginsname"
msgid "Name"
msgstr "Name"

#: ulng.rsoptpluginsregisteredfor
msgctxt "ulng.rsoptpluginsregisteredfor"
msgid "Registered for"
msgstr "Registriert für"

#: ulng.rsoptsearchcase
msgid "&Sensitive;&Insensitive"
msgstr "Genaue &Schreibweise;unabhängig von der Schreibwe&ise"

#: ulng.rsoptsearchitems
msgid "&Files;Di&rectories;Files a&nd Directories"
msgstr "&Dateien;Ve&rzeichnisse;Dateien u&nd Verzeichnisse"

#: ulng.rsoptsearchopt
msgid "&Hide filter panel when not focused;Keep saving setting modifications for next session"
msgstr "Verstecke Filterpanel wenn es nicht ausgewä&hlt ist;Einstellung Änderungen speichern für die nächste Sitzung"

#: ulng.rsoptsortcasesens
msgid "not case sensitive;according to locale settings (aAbBcC);first upper then lower case (ABCabc)"
msgstr "Nicht abhängig von der Schreibweise; abhängig von den lokalen Einstellungen (aAbBcC); erst Groß, dann klein (ABCabc)"

#: ulng.rsoptsortfoldermode
msgid "sort by name and show first;sort like files and show first;sort like files"
msgstr "Nach Namen sortieren und ersten anzeigen;wie Dateien sortieren und erste anzeigen;wie Dateien sortieren"

#: ulng.rsoptsortmethod
msgid "Alphabetical, considering accents;Natural sorting: alphabetical and numbers"
msgstr "Alphabetisch, Akzentuierungen beachten;Natürliche Sortierung: alphabetisch und numerisch"

#: ulng.rsopttabsposition
msgid "Top;Bottom;"
msgstr "Oben;Unten;"

#: ulng.rsopttoolbarbuttontype
msgid "S&eparator;Inte&rnal command;E&xternal command;Men&u"
msgstr "Tr&ennendes Element;&Interner Befehl;E&xterner Befehl;Men&ü"

#: ulng.rsopttypeofduplicatedrename
msgid "DC legacy - Copy (x) filename.ext;Windows - filename (x).ext;Other - filename(x).ext"
msgstr "DC bisher: \"Kopie (x) Dateiname.ext\";Windows: \"Dateiname (x).ext\";Andere: \"Dateiname(x).ext\""

#: ulng.rsoptupdatedfilesposition
msgid "don't change position;use the same setting as for new files;to sorted position"
msgstr "Position nicht verändern;die gleiche Einstellung wie für neue Dateien nutzen;an festgelegte Position"

#: ulng.rspropscontains
msgid "Files: %d, folders: %d"
msgstr "Dateien: %d, Verzeichnisse: %d"

#: ulng.rspropserrchmod
msgid "Can not change access rights for \"%s\""
msgstr "Kann die Zugriffsrechte für die Datei  \"%s\" nicht ändern"

#: ulng.rspropserrchown
msgid "Can not change owner for \"%s\""
msgstr "Kann den Besitzer für \"%s\" nicht ändern"

#: ulng.rspropsfile
msgctxt "ulng.rspropsfile"
msgid "File"
msgstr "Datei"

#: ulng.rspropsfolder
msgctxt "ulng.rspropsfolder"
msgid "Directory"
msgstr "Verzeichnis"

#: ulng.rspropsnmdpipe
msgid "Named pipe"
msgstr "Benannte Pipe"

#: ulng.rspropssocket
msgid "Socket"
msgstr "Socket"

#: ulng.rspropsspblkdev
msgid "Special block device"
msgstr "Spezielles Block-device"

#: ulng.rspropsspchrdev
msgid "Special character device"
msgstr "Spezielles Buchstaben-device"

#: ulng.rspropssymlink
msgid "Symbolic link"
msgstr "Symbolischer Link"

#: ulng.rspropsunknowntype
msgid "Unknown type"
msgstr "Unbekannter Typ"

#: ulng.rssearchresult
msgid "Search result"
msgstr "Suchergebnis"

#: ulng.rssearchstatus
msgid "SEARCH"
msgstr "SUCHE"

#: ulng.rssearchtemplateunnamed
msgid "<unnamed template>"
msgstr "<unbenannte Vorlage>"

#: ulng.rssearchwithdsxplugininprogress
msgid ""
"A file search using DSX plugin is already in progress.\n"
"We need that one to be completed before to launch a new one.\n"
msgstr ""

#: ulng.rssearchwithwdxplugininprogress
msgid ""
"A file search using WDX plugin is already in progress.\n"
"We need that one to be completed before to launch a new one.\n"
msgstr ""

#: ulng.rsselectdir
msgid "Select a directory"
msgstr "Wähle ein Verzeichnis"

#: ulng.rsselectyoufindfileswindow
msgid "Select your window"
msgstr ""

#: ulng.rsshowhelpfor
msgid "&Show help for %s"
msgstr "&Zeige Hilfe zu %s"

#: ulng.rssimplewordall
msgctxt "ulng.rssimplewordall"
msgid "All"
msgstr "Alle"

#: ulng.rssimplewordcategory
msgctxt "ulng.rssimplewordcategory"
msgid "Category"
msgstr "Kategorie"

#: ulng.rssimplewordcolumnsingular
msgid "Column"
msgstr "Spalte"

#: ulng.rssimplewordcommand
msgctxt "ulng.rssimplewordcommand"
msgid "Command"
msgstr "Befehl"

#: ulng.rssimplewordfilename
msgid "Filename"
msgstr "Dateiname"

#: ulng.rssimplewordfiles
msgid "files"
msgstr "Dateien"

#: ulng.rssimplewordletter
msgid "Letter"
msgstr ""

#: ulng.rssimplewordparameter
msgid "Param"
msgstr "Parameter"

#: ulng.rssimplewordresult
msgid "Result"
msgstr "Ergebnis"

#: ulng.rssimplewordworkdir
msgid "WorkDir"
msgstr "Arbeitsverzeichnis"

#: ulng.rssizeunitbytes
msgid "Bytes"
msgstr "Bytes"

#: ulng.rssizeunitgbytes
msgctxt "ulng.rssizeunitgbytes"
msgid "Gigabytes"
msgstr "Gigabytes"

#: ulng.rssizeunitkbytes
msgctxt "ulng.rssizeunitkbytes"
msgid "Kilobytes"
msgstr "Kilobytes"

#: ulng.rssizeunitmbytes
msgctxt "ulng.rssizeunitmbytes"
msgid "Megabytes"
msgstr "Megabytes"

#: ulng.rssizeunittbytes
msgid "Terabytes"
msgstr "Terabytes"

#: ulng.rsspacemsg
msgid "Files: %d, Dirs: %d, Size: %s (%s bytes)"
msgstr "Dateien: %d, Verzeichnisse: %d, Grösse: %s (%s Bytes)"

#: ulng.rsspliterrdirectory
msgid "Unable to create target directory!"
msgstr "Kann Zielverzeichnis nicht erstellen"

#: ulng.rsspliterrfilesize
msgid "Incorrect file size format!"
msgstr "Falsches Dateigrössenformat!"

#: ulng.rsspliterrsplitfile
msgid "Unable to split the file!"
msgstr "Kann Datei nicht teilen!"

#: ulng.rssplitmsgmanyparts
msgid "The number of parts is more than 100! Continue?"
msgstr "Die Anzahl der Teile ist grösser als 100! Fortfahren?"

#: ulng.rssplitpredefinedsizes
msgid "Automatic;1457664B - 3.5\" High Density 1.44M;1213952B - 5.25\" High Density 1.2M;730112B - 3.5\" Double Density 720K;362496B - 5.25\" Double Density 360K;98078KB - ZIP 100MB;650MB - CD 650MB;700MB - CD 700MB;4482MB - DVD+R"
msgstr ""

#: ulng.rssplitseldir
msgid "Select directory:"
msgstr "Wähle Verzeichnis:"

#: ulng.rsstraccents
msgid "á;â;à;å;ã;ä;ç;é;ê;è;ë;í;î;ì;ï;ñ;ó;ô;ò;ø;õ;ö;ú;û;ù;ü;ÿ;Á;Â;À;Å;Ã;Ä;Ç;É;Ê;È;Ë;Í;Í;Ì;Ï;Ñ;Ó;Ô;Ø;Õ;Ö;ß;Ú;Û;Ù;Ü;Ÿ;¿;¡;œ;æ;Æ;Œ"
msgstr ""

#: ulng.rsstraccentsstripped
msgid "a;a;a;a;a;a;c;e;e;e;e;i;i;i;i;n;o;o;o;o;o;o;u;u;u;u;y;A;A;A;A;A;A;C;E;E;E;E;I;I;I;I;N;O;O;O;O;O;B;U;U;U;U;Y;?;!;oe;ae;AE;OE"
msgstr ""

#: ulng.rsstrpreviewjustpreview
msgid "Just preview"
msgstr ""

#: ulng.rsstrpreviewothers
msgid "Others"
msgstr ""

#: ulng.rsstrpreviewsearchingletters
msgid "OU"
msgstr ""

#: ulng.rsstrpreviewsidenote
msgid "Side note"
msgstr ""

#: ulng.rsstrpreviewwordwithoutsearched1
msgid "Flat"
msgstr ""

#: ulng.rsstrpreviewwordwithoutsearched2
msgid "Limited"
msgstr ""

#: ulng.rsstrpreviewwordwithoutsearched3
msgid "Simple"
msgstr ""

#: ulng.rsstrpreviewwordwithsearched1
msgid "Fabulous"
msgstr ""

#: ulng.rsstrpreviewwordwithsearched2
msgid "Marvelous"
msgstr ""

#: ulng.rsstrpreviewwordwithsearched3
msgid "Tremendous"
msgstr ""

#: ulng.rsstrtvmchoosedirhistory
msgid "Choose your directory from Dir History"
msgstr ""

#: ulng.rsstrtvmchoosefavoritetabs
msgid "Choose you Favorite Tabs:"
msgstr ""

#: ulng.rsstrtvmchoosefromcmdlinehistory
msgid "Choose your command from Command Line History"
msgstr ""

#: ulng.rsstrtvmchoosefrommainmenu
msgid "Choose your action from Main Menu"
msgstr ""

#: ulng.rsstrtvmchoosefromtoolbar
msgid "Choose your action from Maintool bar"
msgstr ""

#: ulng.rsstrtvmchoosehotdirectory
msgid "Choose your directory from Hot Directory:"
msgstr ""

#: ulng.rsstrtvmchooseviewhistory
msgid "Choose your directory from File View History"
msgstr ""

#: ulng.rsstrtvmchooseyourfileordir
msgid "Choose your file or your directory"
msgstr ""

#: ulng.rssymerrcreate
msgid "Error creating symlink."
msgstr "Fehler beim Erstellen des symb. Link."

#: ulng.rssyndefaulttext
msgctxt "ulng.rssyndefaulttext"
msgid "Default text"
msgstr "Standardtext"

#: ulng.rssynlangplaintext
msgctxt "ulng.rssynlangplaintext"
msgid "Plain text"
msgstr "Reiner Text"

#: ulng.rstabsactionondoubleclickchoices
msgid "Do nothing;Close tab;Access Favorite Tabs;Tabs popup menu"
msgstr "Nichts tun;Tab schließen;Favoriten-Tabs;Tabs Popup-Menü"

#: ulng.rstimeunitday
msgctxt "ulng.rstimeunitday"
msgid "Day(s)"
msgstr "Tag(e)"

#: ulng.rstimeunithour
msgid "Hour(s)"
msgstr "Stunde(n)"

#: ulng.rstimeunitminute
msgid "Minute(s)"
msgstr "Minute(n)"

#: ulng.rstimeunitmonth
msgid "Month(s)"
msgstr "Monat(e)"

#: ulng.rstimeunitsecond
msgid "Second(s)"
msgstr "Sekunde(n)"

#: ulng.rstimeunitweek
msgid "Week(s)"
msgstr "Woche(n)"

#: ulng.rstimeunityear
msgid "Year(s)"
msgstr "Jahr(e)"

#: ulng.rstitlerenamefavtabs
msgid "Rename Favorite Tabs"
msgstr "Favoriten-Tabs umbenennen"

#: ulng.rstitlerenamefavtabsmenu
msgid "Rename Favorite Tabs sub-menu"
msgstr "Untermenü der Favoriten-Tabs umbenennen"

#: ulng.rstooldiffer
msgctxt "ulng.rstooldiffer"
msgid "Differ"
msgstr "Vergleichsprogramm"

#: ulng.rstooleditor
msgctxt "ulng.rstooleditor"
msgid "Editor"
msgstr "Text-Editor"

#: ulng.rstoolerroropeningdiffer
msgid "Error opening differ"
msgstr "Fehler beim Öffnen des Vergleichers"

#: ulng.rstoolerroropeningeditor
msgid "Error opening editor"
msgstr "Fehler beim Öffnen des Editors"

#: ulng.rstoolerroropeningterminal
msgid "Error opening terminal"
msgstr "Fehler beim Starten des Befehlszeilen-Interpreters"

#: ulng.rstoolerroropeningviewer
msgid "Error opening viewer"
msgstr "Fehler beim Öffnen des Betrachters"

#: ulng.rstoolterminal
msgctxt "ulng.rstoolterminal"
msgid "Terminal"
msgstr "Befehlszeilen-Interpreter"

#: ulng.rstoolviewer
msgctxt "ulng.rstoolviewer"
msgid "Viewer"
msgstr "Schnellansicht"

#: ulng.rsunhandledexceptionmessage
msgid "Please report this error to the bug tracker with a description of what you were doing and the following file:%sPress %s to continue or %s to abort the program."
msgstr "Bitte diesen Fehler im Bug-Tracker melden, mit einer Beschreibung was Sie getan haben und der folgenden Datei:%s Klicken Sie auf %s zum Fortfahren oder %s zum Abbrechen."

#: ulng.rsvarbothpanelactivetoinactive
msgid "Both panels, from active to inactive"
msgstr "Beide Panels, von aktiv zu inaktiv"

#: ulng.rsvarbothpanellefttoright
msgid "Both panels, from left to right"
msgstr "Beide Panels, von links nach rechts"

#: ulng.rsvarcurrentpath
msgid "Path of panel"
msgstr "Pfad des Panels"

#: ulng.rsvarencloseelement
msgid "Enclose each name in brackets or what you want"
msgstr "Jeden Namen in Klammern schließen, oder nach Belieben"

#: ulng.rsvarfilenamenoext
msgid "Just filename, no extension"
msgstr "Nur Dateinamen, keine Endung"

#: ulng.rsvarfullpath
msgid "Complete filename (path+filename)"
msgstr "Kompletten Dateinamen (mit Pfad)"

#: ulng.rsvarhelpwith
msgid "Help with \"%\" variables"
msgstr "Hilfe mit \"%\" Variablen"

#: ulng.rsvarinputparam
msgid "Will request request user to enter a parameter with a default suggested value"
msgstr "Fordert Nutzer auf einen Parameter einzugeben, mit einem vorgeschlagenen Standardwert"

#: ulng.rsvarleftpanel
msgid "Left panel"
msgstr "Linkes Panel"

#: ulng.rsvarlistfilename
msgid "Temporary filename of list of filenames"
msgstr "Temporärer Dateiname aus Liste mit Dateinamen"

#: ulng.rsvarlistfullfilename
msgid "Temporary filename of list of complete filenames (path+filename)"
msgstr "Temporärer Dateiname aus Liste mit kompletten Dateinamen (Pfad und Dateiname)"

#: ulng.rsvarlistinutf16
msgid "Filenames in list in UTF-16 with BOM"
msgstr "Dateinamen in Liste in UTF-16 mit BOM"

#: ulng.rsvarlistinutf16quoted
msgid "Filenames in list in UTF-16 with BOM, inside double quotes"
msgstr "Dateinamen in Liste in UTF-16 mit BOM, in Anführungszeichen"

#: ulng.rsvarlistinutf8
msgid "Filenames in list in UTF-8"
msgstr "Dateinamen in Liste in UTF-8"

#: ulng.rsvarlistinutf8quoted
msgid "Filenames in list in UTF-8, inside double quotes"
msgstr "Dateinamen in Liste in UTF-8, in Anführungszeichen"

#: ulng.rsvarlistrelativefilename
msgid "Temporary filename of list of filenames with relative path"
msgstr "Temporärer Dateiname aus Liste mit Dateinamen mit relativem Pfad"

#: ulng.rsvaronlyextension
msgid "Only file extension"
msgstr "Nur Dateiendung"

#: ulng.rsvaronlyfilename
msgid "Only filename"
msgstr "Nur Dateiname"

#: ulng.rsvarotherexamples
msgid "Other example of what's possible"
msgstr "Anderes Beispiel für Möglichkeiten"

#: ulng.rsvarpath
#, fuzzy
#| msgid "Path, with ending delimiter"
msgid "Path, without ending delimiter"
msgstr "Pfad, mit Trennzeichen am Ende"

#: ulng.rsvarpercentchangetopound
msgid "From here to the end of the line, the percent-variable indicator is the \"#\" sign"
msgstr "Von hier bis zum Ende der Zeile; die Prozent-Anzeige ist das \"#\" Zeichen"

#: ulng.rsvarpercentsign
msgid "Return the percent sign"
msgstr "Setze das Prozentzeichen zurück"

#: ulng.rsvarpoundchangetopercent
msgid "From here to the end of the line, the percent-variable indicator is back the \"%\" sign"
msgstr "Von hier bis zum Ende der Zeile; die Prozent-Anzeige ist hinter dem \"%\" Zeichen"

#: ulng.rsvarprependelement
msgid "Prepend each name with \"-a \" or what you want"
msgstr "Stelle jedem Namen \"-a\" voran, oder was auch immer"

#: ulng.rsvarpromptuserforparam
msgid "%[Prompt user for param;Default value proposed]"
msgstr "% [Frage den Nutzer nach Parameter;Standardwert wird vorgeschlagen]"

#: ulng.rsvarrelativepathandfilename
msgid "Filename with relative path"
msgstr "Dateiname mit relativem Pfad"

#: ulng.rsvarrightpanel
msgid "Right panel"
msgstr "Rechtes Panel"

#: ulng.rsvarsecondelementrightpanel
msgid "Full path of second selected file in right panel"
msgstr "Voller Pfad der zweiten gewählten Datei im rechten Panel"

#: ulng.rsvarshowcommandprior
msgid "Show command prior execute"
msgstr "Zeige Befehl vor der Ausführung"

#: ulng.rsvarsimplemessage
msgid "%[Simple message]"
msgstr "% [Einfache Nachricht]"

#: ulng.rsvarsimpleshowmessage
msgid "Will show a simple message"
msgstr "Zeigt eine einfache Nachricht"

#: ulng.rsvarsourcepanel
msgid "Active panel (source)"
msgstr "Aktives Panel (Quelle)"

#: ulng.rsvartargetpanel
msgid "Inactive panel (target)"
msgstr "Inaktives Panel (Ziel)"

#: ulng.rsvarwillbequoted
msgid "Filenames will be quoted from here (default)"
msgstr "Dateinamen werden von hier aus zitiert (Standard)."

#: ulng.rsvarwilldointerminal
msgid "Command will be done in terminal, remaining opened at the end"
msgstr "Befehle werden im Terminal ausgeführt. Dies bleibt am Ende geöffnet."

#: ulng.rsvarwillhaveendingdelimiter
msgid "Paths will have ending delimiter"
msgstr "Pfade werden am Ende ein trennendes Zeichen haben"

#: ulng.rsvarwillnotbequoted
msgid "Filenames will not be quoted from here"
msgstr "Dateinamen werden von hier aus nicht zitiert"

#: ulng.rsvarwillnotdointerminal
msgid "Command will be done in terminal, closed at the end"
msgstr "Befehl wird im Terminal ausgeführt. Dies wird nach der Ausführung geschlossen"

#: ulng.rsvarwillnothaveendingdelimiter
msgid "Paths will not have ending delimiter (default)"
msgstr "Pfade werden am Ende kein trennendes Zeichen haben (Standard)"

#: ulng.rsvfsnetwork
msgctxt "ulng.rsvfsnetwork"
msgid "Network"
msgstr "&Netzwerk"

#: ulng.rsviewabouttext
msgid "Internal Viewer of Double Commander."
msgstr "Interner Betrachter des Double Commander"

#: ulng.rsviewbadquality
msgid "Bad Quality"
msgstr "Schlechte Qualität"

#: ulng.rsviewencoding
msgctxt "ulng.rsviewencoding"
msgid "Encoding"
msgstr "Kodierung"

#: ulng.rsviewimagetype
msgid "Image Type"
msgstr "Bildtyp"

#: ulng.rsviewnewsize
msgctxt "ulng.rsviewnewsize"
msgid "New Size"
msgstr "Neue Grösse"

#: ulng.rsviewnotfound
msgid "%s not found!"
msgstr "%s nicht gefunden!"

#: ulng.rsviewwithexternalviewer
msgid "with external viewer"
msgstr "Mit externem Betrachter"

#: ulng.rsviewwithinternalviewer
msgid "with internal viewer"
msgstr "Mit internem Betrachter"

#: ulng.rsxreplacements
msgid "Number of replacement: %d"
msgstr "Anzahl der Ersetzungen: %d"

#: ulng.rszeroreplacement
msgid "No replacement took place."
msgstr "Nichts wurde ersetzt."
